Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/56478/44838/atl-hpa054105_anti-dlgap4-pab-atl-hpa054105_56285__55278.1783642042.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/56478/44838/atl-hpa054105_anti-dlgap4-pab-atl-hpa054105_56285__55278.1783642042.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GVQVEDDWRSSVPSHSMSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSISIDAGPRQAPKIAQIKRNLSYGDNSDPAL |
| Gene Sequence | GVQVEDDWRSSVPSHSMSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSISIDAGPRQAPKIAQIKRNLSYGDNSDPAL |
| Gene ID - Mouse | ENSMUSG00000061689 |
| Gene ID - Rat | ENSRNOG00000020225 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DLGAP4 pAb (ATL-HPA054105) | |
| Datasheet | Anti DLGAP4 pAb (ATL-HPA054105) Datasheet (External Link) |
| Vendor Page | Anti DLGAP4 pAb (ATL-HPA054105) at Atlas Antibodies |
| Documents & Links for Anti DLGAP4 pAb (ATL-HPA054105) | |
| Datasheet | Anti DLGAP4 pAb (ATL-HPA054105) Datasheet (External Link) |
| Vendor Page | Anti DLGAP4 pAb (ATL-HPA054105) |
| Citations for Anti DLGAP4 pAb (ATL-HPA054105) – 1 Found |
| Schob, Claudia; Morellini, Fabio; Ohana, Ora; Bakota, Lidia; Hrynchak, Mariya V; Brandt, Roland; Brockmann, Marco D; Cichon, Nicole; Hartung, Henrike; Hanganu-Opatz, Ileana L; Kraus, Vanessa; Scharf, Sarah; Herrmans-Borgmeyer, Irm; Schweizer, Michaela; Kuhl, Dietmar; Wöhr, Markus; Vörckel, Karl J; Calzada-Wack, Julia; Fuchs, Helmut; Gailus-Durner, Valérie; Hrabě de Angelis, Martin; Garner, Craig C; Kreienkamp, Hans-Jürgen; Kindler, Stefan. Cognitive impairment and autistic-like behaviour in SAPAP4-deficient mice. Translational Psychiatry. 2019;9(1):7. PubMed |

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/56478/44838/atl-hpa054105_anti-dlgap4-pab-atl-hpa054105_56285__55278.1783642042.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/56478/44838/atl-hpa054105_anti-dlgap4-pab-atl-hpa054105_56285__55278.1783642042.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GVQVEDDWRSSVPSHSMSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSISIDAGPRQAPKIAQIKRNLSYGDNSDPAL |
| Gene Sequence | GVQVEDDWRSSVPSHSMSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSISIDAGPRQAPKIAQIKRNLSYGDNSDPAL |
| Gene ID - Mouse | ENSMUSG00000061689 |
| Gene ID - Rat | ENSRNOG00000020225 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DLGAP4 pAb (ATL-HPA054105) | |
| Datasheet | Anti DLGAP4 pAb (ATL-HPA054105) Datasheet (External Link) |
| Vendor Page | Anti DLGAP4 pAb (ATL-HPA054105) at Atlas Antibodies |
| Documents & Links for Anti DLGAP4 pAb (ATL-HPA054105) | |
| Datasheet | Anti DLGAP4 pAb (ATL-HPA054105) Datasheet (External Link) |
| Vendor Page | Anti DLGAP4 pAb (ATL-HPA054105) |
| Citations for Anti DLGAP4 pAb (ATL-HPA054105) – 1 Found |
| Schob, Claudia; Morellini, Fabio; Ohana, Ora; Bakota, Lidia; Hrynchak, Mariya V; Brandt, Roland; Brockmann, Marco D; Cichon, Nicole; Hartung, Henrike; Hanganu-Opatz, Ileana L; Kraus, Vanessa; Scharf, Sarah; Herrmans-Borgmeyer, Irm; Schweizer, Michaela; Kuhl, Dietmar; Wöhr, Markus; Vörckel, Karl J; Calzada-Wack, Julia; Fuchs, Helmut; Gailus-Durner, Valérie; Hrabě de Angelis, Martin; Garner, Craig C; Kreienkamp, Hans-Jürgen; Kindler, Stefan. Cognitive impairment and autistic-like behaviour in SAPAP4-deficient mice. Translational Psychiatry. 2019;9(1):7. PubMed |