Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPII |
| Gene Sequence | QNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPII |
| Gene ID - Mouse | ENSMUSG00000004789 |
| Gene ID - Rat | ENSRNOG00000005061 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DLST pAb (ATL-HPA003010 w/enhanced validation) | |
| Datasheet | Anti DLST pAb (ATL-HPA003010 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DLST pAb (ATL-HPA003010 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DLST pAb (ATL-HPA003010 w/enhanced validation) | |
| Datasheet | Anti DLST pAb (ATL-HPA003010 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DLST pAb (ATL-HPA003010 w/enhanced validation) |
| Citations for Anti DLST pAb (ATL-HPA003010 w/enhanced validation) – 4 Found |
| Joseph, Sunil; Yuen, Alex; Singh, Vijender; Hmama, Zakaria. Mycobacterium tuberculosis Cpn60.2 (GroEL2) blocks macrophage apoptosis via interaction with mitochondrial mortalin. Biology Open. 2017;6(4):481-488. PubMed |
| Remacha, Laura; Pirman, David; Mahoney, Christopher E; Coloma, Javier; Calsina, Bruna; Currás-Freixes, Maria; Letón, Rocío; Torres-Pérez, Rafael; Richter, Susan; Pita, Guillermo; Herráez, Belén; Cianchetta, Giovanni; Honrado, Emiliano; Maestre, Lorena; Urioste, Miguel; Aller, Javier; García-Uriarte, Óscar; Gálvez, María Ángeles; Luque, Raúl M; Lahera, Marcos; Moreno-Rengel, Cristina; Eisenhofer, Graeme; Montero-Conde, Cristina; Rodríguez-Antona, Cristina; Llorca, Óscar; Smolen, Gromoslaw A; Robledo, Mercedes; Cascón, Alberto. Recurrent Germline DLST Mutations in Individuals with Multiple Pheochromocytomas and Paragangliomas. American Journal Of Human Genetics. 2019;104(4):651-664. PubMed |
| Dobolyi, Arpad; Bago, Attila; Palkovits, Miklos; Nemeria, Natalia S; Jordan, Frank; Doczi, Judit; Ambrus, Attila; Adam-Vizi, Vera; Chinopoulos, Christos. Exclusive neuronal detection of KGDHC-specific subunits in the adult human brain cortex despite pancellular protein lysine succinylation. Brain Structure & Function. 2020;225(2):639-667. PubMed |
| Yap, Zheng Yie; Strucinska, Klaudia; Matsuzaki, Satoshi; Lee, Sukyeong; Si, Yue; Humphries, Kenneth; Tarnopolsky, Mark A; Yoon, Wan Hee. A biallelic pathogenic variant in the OGDH gene results in a neurological disorder with features of a mitochondrial disease. Journal Of Inherited Metabolic Disease. 2021;44(2):388-400. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPII |
| Gene Sequence | QNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPII |
| Gene ID - Mouse | ENSMUSG00000004789 |
| Gene ID - Rat | ENSRNOG00000005061 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DLST pAb (ATL-HPA003010 w/enhanced validation) | |
| Datasheet | Anti DLST pAb (ATL-HPA003010 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DLST pAb (ATL-HPA003010 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DLST pAb (ATL-HPA003010 w/enhanced validation) | |
| Datasheet | Anti DLST pAb (ATL-HPA003010 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DLST pAb (ATL-HPA003010 w/enhanced validation) |
| Citations for Anti DLST pAb (ATL-HPA003010 w/enhanced validation) – 4 Found |
| Joseph, Sunil; Yuen, Alex; Singh, Vijender; Hmama, Zakaria. Mycobacterium tuberculosis Cpn60.2 (GroEL2) blocks macrophage apoptosis via interaction with mitochondrial mortalin. Biology Open. 2017;6(4):481-488. PubMed |
| Remacha, Laura; Pirman, David; Mahoney, Christopher E; Coloma, Javier; Calsina, Bruna; Currás-Freixes, Maria; Letón, Rocío; Torres-Pérez, Rafael; Richter, Susan; Pita, Guillermo; Herráez, Belén; Cianchetta, Giovanni; Honrado, Emiliano; Maestre, Lorena; Urioste, Miguel; Aller, Javier; García-Uriarte, Óscar; Gálvez, María Ángeles; Luque, Raúl M; Lahera, Marcos; Moreno-Rengel, Cristina; Eisenhofer, Graeme; Montero-Conde, Cristina; Rodríguez-Antona, Cristina; Llorca, Óscar; Smolen, Gromoslaw A; Robledo, Mercedes; Cascón, Alberto. Recurrent Germline DLST Mutations in Individuals with Multiple Pheochromocytomas and Paragangliomas. American Journal Of Human Genetics. 2019;104(4):651-664. PubMed |
| Dobolyi, Arpad; Bago, Attila; Palkovits, Miklos; Nemeria, Natalia S; Jordan, Frank; Doczi, Judit; Ambrus, Attila; Adam-Vizi, Vera; Chinopoulos, Christos. Exclusive neuronal detection of KGDHC-specific subunits in the adult human brain cortex despite pancellular protein lysine succinylation. Brain Structure & Function. 2020;225(2):639-667. PubMed |
| Yap, Zheng Yie; Strucinska, Klaudia; Matsuzaki, Satoshi; Lee, Sukyeong; Si, Yue; Humphries, Kenneth; Tarnopolsky, Mark A; Yoon, Wan Hee. A biallelic pathogenic variant in the OGDH gene results in a neurological disorder with features of a mitochondrial disease. Journal Of Inherited Metabolic Disease. 2021;44(2):388-400. PubMed |