Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDSDDTIQASEESAPQGQDSAQDTTSE |
| Gene Sequence | QYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDSDDTIQASEESAPQGQDSAQDTTSE |
| Gene ID - Mouse | ENSMUSG00000029307 |
| Gene ID - Rat | ENSRNOG00000002167 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DMP1 pAb (ATL-HPA037465) | |
| Datasheet | Anti DMP1 pAb (ATL-HPA037465) Datasheet (External Link) |
| Vendor Page | Anti DMP1 pAb (ATL-HPA037465) at Atlas Antibodies |
| Documents & Links for Anti DMP1 pAb (ATL-HPA037465) | |
| Datasheet | Anti DMP1 pAb (ATL-HPA037465) Datasheet (External Link) |
| Vendor Page | Anti DMP1 pAb (ATL-HPA037465) |
| Citations for Anti DMP1 pAb (ATL-HPA037465) – 2 Found |
| Verma, Manish; Callio, Jason; Otero, P Anthony; Sekler, Israel; Wills, Zachary P; Chu, Charleen T. Mitochondrial Calcium Dysregulation Contributes to Dendrite Degeneration Mediated by PD/LBD-Associated LRRK2 Mutants. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2017;37(46):11151-11165. PubMed |
| Matsui, Mikiko; Kobayashi, Tomoko; Tsutsui, Takeo W. CD146 positive human dental pulp stem cells promote regeneration of dentin/pulp-like structures. Human Cell. 2018;31(2):127-138. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDSDDTIQASEESAPQGQDSAQDTTSE |
| Gene Sequence | QYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDSDDTIQASEESAPQGQDSAQDTTSE |
| Gene ID - Mouse | ENSMUSG00000029307 |
| Gene ID - Rat | ENSRNOG00000002167 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DMP1 pAb (ATL-HPA037465) | |
| Datasheet | Anti DMP1 pAb (ATL-HPA037465) Datasheet (External Link) |
| Vendor Page | Anti DMP1 pAb (ATL-HPA037465) at Atlas Antibodies |
| Documents & Links for Anti DMP1 pAb (ATL-HPA037465) | |
| Datasheet | Anti DMP1 pAb (ATL-HPA037465) Datasheet (External Link) |
| Vendor Page | Anti DMP1 pAb (ATL-HPA037465) |
| Citations for Anti DMP1 pAb (ATL-HPA037465) – 2 Found |
| Verma, Manish; Callio, Jason; Otero, P Anthony; Sekler, Israel; Wills, Zachary P; Chu, Charleen T. Mitochondrial Calcium Dysregulation Contributes to Dendrite Degeneration Mediated by PD/LBD-Associated LRRK2 Mutants. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2017;37(46):11151-11165. PubMed |
| Matsui, Mikiko; Kobayashi, Tomoko; Tsutsui, Takeo W. CD146 positive human dental pulp stem cells promote regeneration of dentin/pulp-like structures. Human Cell. 2018;31(2):127-138. PubMed |