Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEPSSFTVTPVI |
| Gene Sequence | LAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEPSSFTVTPVI |
| Gene ID - Mouse | ENSMUSG00000024837 |
| Gene ID - Rat | ENSRNOG00000016075 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) | |
| Datasheet | Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) | |
| Datasheet | Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) |
| Citations for Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) – 4 Found |
| von Kopylow, Kathrein; Staege, Hannah; Spiess, Andrej-Nikolai; Schulze, Wolfgang; Will, Hans; Primig, Michael; Kirchhoff, Christiane. Differential marker protein expression specifies rarefaction zone-containing human Adark spermatogonia. Reproduction (Cambridge, England). 2012;143(1):45-57. PubMed |
| von Kopylow, Kathrein; Staege, Hannah; Schulze, Wolfgang; Will, Hans; Kirchhoff, Christiane. Fibroblast growth factor receptor 3 is highly expressed in rarely dividing human type A spermatogonia. Histochemistry And Cell Biology. 2012;138(5):759-72. PubMed |
| Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88. PubMed |
| Richardson, Nainoa; Gillot, Isabelle; Gregoire, Elodie P; Youssef, Sameh A; de Rooij, Dirk; de Bruin, Alain; De Cian, Marie-Cécile; Chaboissier, Marie-Christine. Sox8 and Sox9 act redundantly for ovarian-to-testicular fate reprogramming in the absence of R-spondin1 in mouse sex reversals. Elife. 2020;9( 32450947) PubMed |
| Product Specifications | |
| Application | WB, IHC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEPSSFTVTPVI |
| Gene Sequence | LAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEPSSFTVTPVI |
| Gene ID - Mouse | ENSMUSG00000024837 |
| Gene ID - Rat | ENSRNOG00000016075 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) | |
| Datasheet | Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) | |
| Datasheet | Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) |
| Citations for Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) – 4 Found |
| von Kopylow, Kathrein; Staege, Hannah; Spiess, Andrej-Nikolai; Schulze, Wolfgang; Will, Hans; Primig, Michael; Kirchhoff, Christiane. Differential marker protein expression specifies rarefaction zone-containing human Adark spermatogonia. Reproduction (Cambridge, England). 2012;143(1):45-57. PubMed |
| von Kopylow, Kathrein; Staege, Hannah; Schulze, Wolfgang; Will, Hans; Kirchhoff, Christiane. Fibroblast growth factor receptor 3 is highly expressed in rarely dividing human type A spermatogonia. Histochemistry And Cell Biology. 2012;138(5):759-72. PubMed |
| Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88. PubMed |
| Richardson, Nainoa; Gillot, Isabelle; Gregoire, Elodie P; Youssef, Sameh A; de Rooij, Dirk; de Bruin, Alain; De Cian, Marie-Cécile; Chaboissier, Marie-Christine. Sox8 and Sox9 act redundantly for ovarian-to-testicular fate reprogramming in the absence of R-spondin1 in mouse sex reversals. Elife. 2020;9( 32450947) PubMed |