Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETEEGENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLD |
| Gene Sequence | ILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETEEGENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLD |
| Gene ID - Mouse | ENSMUSG00000033826 |
| Gene ID - Rat | ENSRNOG00000000542 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DNAH8 pAb (ATL-HPA028447) | |
| Datasheet | Anti DNAH8 pAb (ATL-HPA028447) Datasheet (External Link) |
| Vendor Page | Anti DNAH8 pAb (ATL-HPA028447) at Atlas Antibodies |
| Documents & Links for Anti DNAH8 pAb (ATL-HPA028447) | |
| Datasheet | Anti DNAH8 pAb (ATL-HPA028447) Datasheet (External Link) |
| Vendor Page | Anti DNAH8 pAb (ATL-HPA028447) |
| Citations for Anti DNAH8 pAb (ATL-HPA028447) – 5 Found |
| Wang, Yu; Ledet, Russell J; Imberg-Kazdan, Keren; Logan, Susan K; Garabedian, Michael J. Dynein axonemal heavy chain 8 promotes androgen receptor activity and associates with prostate cancer progression. Oncotarget. 2016;7(31):49268-49280. PubMed |
| Song, Feifeng; Zhang, Yiwen; Pan, Zongfu; Hu, Xiaoping; Yi, Yaodong; Zheng, Xiaochun; Wei, Haibin; Huang, Ping. Identification of novel key genes associated with the metastasis of prostate cancer based on bioinformatics prediction and validation. Cancer Cell International. 2021;21(1):559. PubMed |
| Whitfield, Marjorie; Thomas, Lucie; Bequignon, Emilie; Schmitt, Alain; Stouvenel, Laurence; Montantin, Guy; Tissier, Sylvie; Duquesnoy, Philippe; Copin, Bruno; Chantot, Sandra; Dastot, Florence; Faucon, Catherine; Barbotin, Anne Laure; Loyens, Anne; Siffroi, Jean-Pierre; Papon, Jean-François; Escudier, Estelle; Amselem, Serge; Mitchell, Valérie; Touré, Aminata; Legendre, Marie. Mutations in DNAH17, Encoding a Sperm-Specific Axonemal Outer Dynein Arm Heavy Chain, Cause Isolated Male Infertility Due to Asthenozoospermia. American Journal Of Human Genetics. 2019;105(1):198-212. PubMed |
| Aprea, Isabella; Nöthe-Menchen, Tabea; Dougherty, Gerard W; Raidt, Johanna; Loges, Niki T; Kaiser, Thomas; Wallmeier, Julia; Olbrich, Heike; Strünker, Timo; Kliesch, Sabine; Pennekamp, Petra; Omran, Heymut. Motility of efferent duct cilia aids passage of sperm cells through the male reproductive system. Molecular Human Reproduction. 2021;27(3) PubMed |
| Aprea, Isabella; Raidt, Johanna; Höben, Inga Marlena; Loges, Niki Tomas; Nöthe-Menchen, Tabea; Pennekamp, Petra; Olbrich, Heike; Kaiser, Thomas; Biebach, Luisa; Tüttelmann, Frank; Horvath, Judit; Schubert, Maria; Krallmann, Claudia; Kliesch, Sabine; Omran, Heymut. Defects in the cytoplasmic assembly of axonemal dynein arms cause morphological abnormalities and dysmotility in sperm cells leading to male infertility. Plos Genetics. 2021;17(2):e1009306. PubMed |


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETEEGENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLD |
| Gene Sequence | ILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETEEGENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLD |
| Gene ID - Mouse | ENSMUSG00000033826 |
| Gene ID - Rat | ENSRNOG00000000542 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DNAH8 pAb (ATL-HPA028447) | |
| Datasheet | Anti DNAH8 pAb (ATL-HPA028447) Datasheet (External Link) |
| Vendor Page | Anti DNAH8 pAb (ATL-HPA028447) at Atlas Antibodies |
| Documents & Links for Anti DNAH8 pAb (ATL-HPA028447) | |
| Datasheet | Anti DNAH8 pAb (ATL-HPA028447) Datasheet (External Link) |
| Vendor Page | Anti DNAH8 pAb (ATL-HPA028447) |
| Citations for Anti DNAH8 pAb (ATL-HPA028447) – 5 Found |
| Wang, Yu; Ledet, Russell J; Imberg-Kazdan, Keren; Logan, Susan K; Garabedian, Michael J. Dynein axonemal heavy chain 8 promotes androgen receptor activity and associates with prostate cancer progression. Oncotarget. 2016;7(31):49268-49280. PubMed |
| Song, Feifeng; Zhang, Yiwen; Pan, Zongfu; Hu, Xiaoping; Yi, Yaodong; Zheng, Xiaochun; Wei, Haibin; Huang, Ping. Identification of novel key genes associated with the metastasis of prostate cancer based on bioinformatics prediction and validation. Cancer Cell International. 2021;21(1):559. PubMed |
| Whitfield, Marjorie; Thomas, Lucie; Bequignon, Emilie; Schmitt, Alain; Stouvenel, Laurence; Montantin, Guy; Tissier, Sylvie; Duquesnoy, Philippe; Copin, Bruno; Chantot, Sandra; Dastot, Florence; Faucon, Catherine; Barbotin, Anne Laure; Loyens, Anne; Siffroi, Jean-Pierre; Papon, Jean-François; Escudier, Estelle; Amselem, Serge; Mitchell, Valérie; Touré, Aminata; Legendre, Marie. Mutations in DNAH17, Encoding a Sperm-Specific Axonemal Outer Dynein Arm Heavy Chain, Cause Isolated Male Infertility Due to Asthenozoospermia. American Journal Of Human Genetics. 2019;105(1):198-212. PubMed |
| Aprea, Isabella; Nöthe-Menchen, Tabea; Dougherty, Gerard W; Raidt, Johanna; Loges, Niki T; Kaiser, Thomas; Wallmeier, Julia; Olbrich, Heike; Strünker, Timo; Kliesch, Sabine; Pennekamp, Petra; Omran, Heymut. Motility of efferent duct cilia aids passage of sperm cells through the male reproductive system. Molecular Human Reproduction. 2021;27(3) PubMed |
| Aprea, Isabella; Raidt, Johanna; Höben, Inga Marlena; Loges, Niki Tomas; Nöthe-Menchen, Tabea; Pennekamp, Petra; Olbrich, Heike; Kaiser, Thomas; Biebach, Luisa; Tüttelmann, Frank; Horvath, Judit; Schubert, Maria; Krallmann, Claudia; Kliesch, Sabine; Omran, Heymut. Defects in the cytoplasmic assembly of axonemal dynein arms cause morphological abnormalities and dysmotility in sperm cells leading to male infertility. Plos Genetics. 2021;17(2):e1009306. PubMed |