Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGL |
| Gene Sequence | MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGL |
| Gene ID - Mouse | ENSMUSG00000042523 |
| Gene ID - Rat | ENSRNOG00000042333 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DNAL1 pAb (ATL-HPA053129) | |
| Datasheet | Anti DNAL1 pAb (ATL-HPA053129) Datasheet (External Link) |
| Vendor Page | Anti DNAL1 pAb (ATL-HPA053129) at Atlas Antibodies |
| Documents & Links for Anti DNAL1 pAb (ATL-HPA053129) | |
| Datasheet | Anti DNAL1 pAb (ATL-HPA053129) Datasheet (External Link) |
| Vendor Page | Anti DNAL1 pAb (ATL-HPA053129) |
| Citations for Anti DNAL1 pAb (ATL-HPA053129) – 2 Found |
| Shoemark, Amelia; Frost, Emily; Dixon, Mellisa; Ollosson, Sarah; Kilpin, Kate; Patel, Mitali; Scully, Juliet; Rogers, Andrew V; Mitchison, Hannah M; Bush, Andrew; Hogg, Claire. Accuracy of Immunofluorescence in the Diagnosis of Primary Ciliary Dyskinesia. American Journal Of Respiratory And Critical Care Medicine. 2017;196(1):94-101. PubMed |
| Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) PubMed |
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGL |
| Gene Sequence | MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGL |
| Gene ID - Mouse | ENSMUSG00000042523 |
| Gene ID - Rat | ENSRNOG00000042333 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DNAL1 pAb (ATL-HPA053129) | |
| Datasheet | Anti DNAL1 pAb (ATL-HPA053129) Datasheet (External Link) |
| Vendor Page | Anti DNAL1 pAb (ATL-HPA053129) at Atlas Antibodies |
| Documents & Links for Anti DNAL1 pAb (ATL-HPA053129) | |
| Datasheet | Anti DNAL1 pAb (ATL-HPA053129) Datasheet (External Link) |
| Vendor Page | Anti DNAL1 pAb (ATL-HPA053129) |
| Citations for Anti DNAL1 pAb (ATL-HPA053129) – 2 Found |
| Shoemark, Amelia; Frost, Emily; Dixon, Mellisa; Ollosson, Sarah; Kilpin, Kate; Patel, Mitali; Scully, Juliet; Rogers, Andrew V; Mitchison, Hannah M; Bush, Andrew; Hogg, Claire. Accuracy of Immunofluorescence in the Diagnosis of Primary Ciliary Dyskinesia. American Journal Of Respiratory And Critical Care Medicine. 2017;196(1):94-101. PubMed |
| Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) PubMed |