Loading...
Loading...
Loading...
Loading...
Atlas Antibodies
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/50822/35466/atl-hpa039324_anti-dnm1l-pab-atl-hpa039324-wenhanced-validation_46555__90795.1783635688.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCE |
| Gene Sequence | EADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCE |
| Gene ID - Mouse | ENSMUSG00000022789 |
| Gene ID - Rat | ENSRNOG00000001813 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) | |
| Datasheet | Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) | |
| Datasheet | Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) |
| Citations for Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) – 2 Found |
| Jing, Ren; Hu, Zhao-Kun; Lin, Fei; He, Sheng; Zhang, Sui-Sui; Ge, Wan-Yun; Dai, Hui-Jun; Du, Xue-Ke; Lin, Jin-Yuan; Pan, Ling-Hui. Mitophagy-Mediated mtDNA Release Aggravates Stretching-Induced Inflammation and Lung Epithelial Cell Injury via the TLR9/MyD88/NF-κB Pathway. Frontiers In Cell And Developmental Biology. 8( 33015037):819. PubMed |
| Simpson, Cory L; Tokito, Mariko K; Uppala, Ranjitha; Sarkar, Mrinal K; Gudjonsson, Johann E; Holzbaur, Erika L F. NIX initiates mitochondrial fragmentation via DRP1 to drive epidermal differentiation. Cell Reports. 2021;34(5):108689. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCE |
| Gene Sequence | EADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCE |
| Gene ID - Mouse | ENSMUSG00000022789 |
| Gene ID - Rat | ENSRNOG00000001813 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) | |
| Datasheet | Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) | |
| Datasheet | Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) |
| Citations for Anti DNM1L pAb (ATL-HPA039324 w/enhanced validation) – 2 Found |
| Jing, Ren; Hu, Zhao-Kun; Lin, Fei; He, Sheng; Zhang, Sui-Sui; Ge, Wan-Yun; Dai, Hui-Jun; Du, Xue-Ke; Lin, Jin-Yuan; Pan, Ling-Hui. Mitophagy-Mediated mtDNA Release Aggravates Stretching-Induced Inflammation and Lung Epithelial Cell Injury via the TLR9/MyD88/NF-κB Pathway. Frontiers In Cell And Developmental Biology. 8( 33015037):819. PubMed |
| Simpson, Cory L; Tokito, Mariko K; Uppala, Ranjitha; Sarkar, Mrinal K; Gudjonsson, Johann E; Holzbaur, Erika L F. NIX initiates mitochondrial fragmentation via DRP1 to drive epidermal differentiation. Cell Reports. 2021;34(5):108689. PubMed |
No reviews have been added for this product.