Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KARSVNVKTQALSGYRDQFSLEITGPIMPHSLHSLTMLLKSSQSGSFSAVLYPHEPTAVFNICLQMDKVLDMEVVHKELTNCGLHPNTLEQLSQIPLLGKSSLRN |
| Gene Sequence | KARSVNVKTQALSGYRDQFSLEITGPIMPHSLHSLTMLLKSSQSGSFSAVLYPHEPTAVFNICLQMDKVLDMEVVHKELTNCGLHPNTLEQLSQIPLLGKSSLRN |
| Gene ID - Mouse | ENSMUSG00000022960 |
| Gene ID - Rat | ENSRNOG00000002012 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) | |
| Datasheet | Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) | |
| Datasheet | Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) |
| Citations for Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) – 1 Found |
| Zhang, Jing; Bellani, Marina A; James, Ryan C; Pokharel, Durga; Zhang, Yongqing; Reynolds, John J; McNee, Gavin S; Jackson, Andrew P; Stewart, Grant S; Seidman, Michael M. DONSON and FANCM associate with different replisomes distinguished by replication timing and chromatin domain. Nature Communications. 2020;11(1):3951. PubMed |
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KARSVNVKTQALSGYRDQFSLEITGPIMPHSLHSLTMLLKSSQSGSFSAVLYPHEPTAVFNICLQMDKVLDMEVVHKELTNCGLHPNTLEQLSQIPLLGKSSLRN |
| Gene Sequence | KARSVNVKTQALSGYRDQFSLEITGPIMPHSLHSLTMLLKSSQSGSFSAVLYPHEPTAVFNICLQMDKVLDMEVVHKELTNCGLHPNTLEQLSQIPLLGKSSLRN |
| Gene ID - Mouse | ENSMUSG00000022960 |
| Gene ID - Rat | ENSRNOG00000002012 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) | |
| Datasheet | Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) | |
| Datasheet | Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) |
| Citations for Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) – 1 Found |
| Zhang, Jing; Bellani, Marina A; James, Ryan C; Pokharel, Durga; Zhang, Yongqing; Reynolds, John J; McNee, Gavin S; Jackson, Andrew P; Stewart, Grant S; Seidman, Michael M. DONSON and FANCM associate with different replisomes distinguished by replication timing and chromatin domain. Nature Communications. 2020;11(1):3951. PubMed |
Try browsing our complete catalog of products.