Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45618/25954/atl-hpa022911_anti-dph7-pab-atl-hpa022911_36765__61302.1783628823.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WSWLLFRSLQRAPSWSFPSNLGTKTADLKGASELPTPCHECREDNDGEGHARPQSGMKPLTEGMRKNGTWLQATAATTRDCGVNPEEADSA |
| Gene Sequence | WSWLLFRSLQRAPSWSFPSNLGTKTADLKGASELPTPCHECREDNDGEGHARPQSGMKPLTEGMRKNGTWLQATAATTRDCGVNPEEADSA |
| Gene ID - Mouse | ENSMUSG00000091002 |
| Gene ID - Rat | ENSRNOG00000008102 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DPH7 pAb (ATL-HPA022911) | |
| Datasheet | Anti DPH7 pAb (ATL-HPA022911) Datasheet (External Link) |
| Vendor Page | Anti DPH7 pAb (ATL-HPA022911) at Atlas Antibodies |
| Documents & Links for Anti DPH7 pAb (ATL-HPA022911) | |
| Datasheet | Anti DPH7 pAb (ATL-HPA022911) Datasheet (External Link) |
| Vendor Page | Anti DPH7 pAb (ATL-HPA022911) |
| Citations for Anti DPH7 pAb (ATL-HPA022911) – 2 Found |
| Naamati, Adi; Williamson, James C; Greenwood, Edward Jd; Marelli, Sara; Lehner, Paul J; Matheson, Nicholas J. Functional proteomic atlas of HIV infection in primary human CD4+ T cells. Elife. 2019;8( 30857592) PubMed |
| Marelli, Sara; Williamson, James C; Protasio, Anna V; Naamati, Adi; Greenwood, Edward Jd; Deane, Janet E; Lehner, Paul J; Matheson, Nicholas J. Antagonism of PP2A is an independent and conserved function of HIV-1 Vif and causes cell cycle arrest. Elife. 2020;9( 32292164) PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WSWLLFRSLQRAPSWSFPSNLGTKTADLKGASELPTPCHECREDNDGEGHARPQSGMKPLTEGMRKNGTWLQATAATTRDCGVNPEEADSA |
| Gene Sequence | WSWLLFRSLQRAPSWSFPSNLGTKTADLKGASELPTPCHECREDNDGEGHARPQSGMKPLTEGMRKNGTWLQATAATTRDCGVNPEEADSA |
| Gene ID - Mouse | ENSMUSG00000091002 |
| Gene ID - Rat | ENSRNOG00000008102 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DPH7 pAb (ATL-HPA022911) | |
| Datasheet | Anti DPH7 pAb (ATL-HPA022911) Datasheet (External Link) |
| Vendor Page | Anti DPH7 pAb (ATL-HPA022911) at Atlas Antibodies |
| Documents & Links for Anti DPH7 pAb (ATL-HPA022911) | |
| Datasheet | Anti DPH7 pAb (ATL-HPA022911) Datasheet (External Link) |
| Vendor Page | Anti DPH7 pAb (ATL-HPA022911) |
| Citations for Anti DPH7 pAb (ATL-HPA022911) – 2 Found |
| Naamati, Adi; Williamson, James C; Greenwood, Edward Jd; Marelli, Sara; Lehner, Paul J; Matheson, Nicholas J. Functional proteomic atlas of HIV infection in primary human CD4+ T cells. Elife. 2019;8( 30857592) PubMed |
| Marelli, Sara; Williamson, James C; Protasio, Anna V; Naamati, Adi; Greenwood, Edward Jd; Deane, Janet E; Lehner, Paul J; Matheson, Nicholas J. Antagonism of PP2A is an independent and conserved function of HIV-1 Vif and causes cell cycle arrest. Elife. 2020;9( 32292164) PubMed |