Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VTDSNDNAPTFRQNAYEAFVEENAFNVEILRIPIEDKDLINT |
| Gene Sequence | VTDSNDNAPTFRQNAYEAFVEENAFNVEILRIPIEDKDLINT |
| Gene ID - Mouse | ENSMUSG00000059898 |
| Gene ID - Rat | ENSRNOG00000017159 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DSC3 pAb (ATL-HPA049265 w/enhanced validation) | |
| Datasheet | Anti DSC3 pAb (ATL-HPA049265 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DSC3 pAb (ATL-HPA049265 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DSC3 pAb (ATL-HPA049265 w/enhanced validation) | |
| Datasheet | Anti DSC3 pAb (ATL-HPA049265 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DSC3 pAb (ATL-HPA049265 w/enhanced validation) |
| Citations for Anti DSC3 pAb (ATL-HPA049265 w/enhanced validation) – 1 Found |
| Zhan, Cheng; Yan, Li; Wang, Lin; Sun, Yang; Wang, Xingxing; Lin, Zongwu; Zhang, Yongxing; Shi, Yu; Jiang, Wei; Wang, Qun. Identification of immunohistochemical markers for distinguishing lung adenocarcinoma from squamous cell carcinoma. Journal Of Thoracic Disease. 2015;7(8):1398-405. PubMed |
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VTDSNDNAPTFRQNAYEAFVEENAFNVEILRIPIEDKDLINT |
| Gene Sequence | VTDSNDNAPTFRQNAYEAFVEENAFNVEILRIPIEDKDLINT |
| Gene ID - Mouse | ENSMUSG00000059898 |
| Gene ID - Rat | ENSRNOG00000017159 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DSC3 pAb (ATL-HPA049265 w/enhanced validation) | |
| Datasheet | Anti DSC3 pAb (ATL-HPA049265 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DSC3 pAb (ATL-HPA049265 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DSC3 pAb (ATL-HPA049265 w/enhanced validation) | |
| Datasheet | Anti DSC3 pAb (ATL-HPA049265 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DSC3 pAb (ATL-HPA049265 w/enhanced validation) |
| Citations for Anti DSC3 pAb (ATL-HPA049265 w/enhanced validation) – 1 Found |
| Zhan, Cheng; Yan, Li; Wang, Lin; Sun, Yang; Wang, Xingxing; Lin, Zongwu; Zhang, Yongxing; Shi, Yu; Jiang, Wei; Wang, Qun. Identification of immunohistochemical markers for distinguishing lung adenocarcinoma from squamous cell carcinoma. Journal Of Thoracic Disease. 2015;7(8):1398-405. PubMed |