Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: desmoplakin
Gene Name: DSP
Alternative Gene Name: DPI, DPII, KPPS2, PPKS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054889: 91%, ENSRNOG00000013928: 89%
Entrez Gene ID: 1832
Uniprot ID: P15924
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	RELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGW
Gene Sequence	RELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGW
Gene ID - Mouse	ENSMUSG00000054889
Gene ID - Rat	ENSRNOG00000013928
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DSP pAb (ATL-HPA054950 w/enhanced validation)
Datasheet	Anti DSP pAb (ATL-HPA054950 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti DSP pAb (ATL-HPA054950 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DSP pAb (ATL-HPA054950 w/enhanced validation)
Datasheet	Anti DSP pAb (ATL-HPA054950 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti DSP pAb (ATL-HPA054950 w/enhanced validation)

Citations for Anti DSP pAb (ATL-HPA054950 w/enhanced validation) – 1 Found

Strauss, Philipp; Rivedal, Mariell; Scherer, Andreas; Eikrem, Øystein; Nakken, Sigrid; Beisland, Christian; Bostad, Leif; Flatberg, Arnar; Skandalou, Eleni; Beisvåg, Vidar; Furriol, Jessica; Marti, Hans-Peter. A multiomics disease progression signature of low-risk ccRCC. Scientific Reports. 2022;12(1):13503. PubMed

No related products found

Reviews 0

Reviews

Anti DSP pAb (ATL-HPA054950 w/enhanced validation)

Additional information

Anti DSP pAb (ATL-HPA054950 w/enhanced validation)

Additional information

Specifications

No related products found

Reviews 0

Anti DSP pAb (ATL-HPA054950 w/enhanced validation)

Additional information

Specifications

Anti DSP pAb (ATL-HPA054950 w/enhanced validation)

Additional information

Specifications

Specifications