Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/47060/28659/atl-hpa028053_anti-dtnbp1-pab-atl-hpa028053_39529__97482.1783630814.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKK |
| Gene Sequence | LVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKK |
| Gene ID - Mouse | ENSMUSG00000057531 |
| Gene ID - Rat | ENSRNOG00000048719 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DTNBP1 pAb (ATL-HPA028053) | |
| Datasheet | Anti DTNBP1 pAb (ATL-HPA028053) Datasheet (External Link) |
| Vendor Page | Anti DTNBP1 pAb (ATL-HPA028053) at Atlas Antibodies |
| Documents & Links for Anti DTNBP1 pAb (ATL-HPA028053) | |
| Datasheet | Anti DTNBP1 pAb (ATL-HPA028053) Datasheet (External Link) |
| Vendor Page | Anti DTNBP1 pAb (ATL-HPA028053) |
| Citations for Anti DTNBP1 pAb (ATL-HPA028053) – 1 Found |
| Samardžija, Bobana; Pavešić Radonja, Aristea; Zaharija, Beti; Bergman, Mihaela; Renner, Éva; Palkovits, Miklós; Rubeša, Gordana; Bradshaw, Nicholas J. Protein Aggregation of NPAS3, Implicated in Mental Illness, Is Not Limited to the V304I Mutation. Journal Of Personalized Medicine. 2021;11(11) PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKK |
| Gene Sequence | LVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKK |
| Gene ID - Mouse | ENSMUSG00000057531 |
| Gene ID - Rat | ENSRNOG00000048719 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DTNBP1 pAb (ATL-HPA028053) | |
| Datasheet | Anti DTNBP1 pAb (ATL-HPA028053) Datasheet (External Link) |
| Vendor Page | Anti DTNBP1 pAb (ATL-HPA028053) at Atlas Antibodies |
| Documents & Links for Anti DTNBP1 pAb (ATL-HPA028053) | |
| Datasheet | Anti DTNBP1 pAb (ATL-HPA028053) Datasheet (External Link) |
| Vendor Page | Anti DTNBP1 pAb (ATL-HPA028053) |
| Citations for Anti DTNBP1 pAb (ATL-HPA028053) – 1 Found |
| Samardžija, Bobana; Pavešić Radonja, Aristea; Zaharija, Beti; Bergman, Mihaela; Renner, Éva; Palkovits, Miklós; Rubeša, Gordana; Bradshaw, Nicholas J. Protein Aggregation of NPAS3, Implicated in Mental Illness, Is Not Limited to the V304I Mutation. Journal Of Personalized Medicine. 2021;11(11) PubMed |