Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/52211/38011/atl-hpa042214_anti-dtwd1-pab-atl-hpa042214_49161__65817.1783637411.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LCLASQEVLQKAQQSGRSKCLKCGGSRMFYC |
| Gene Sequence | LCLASQEVLQKAQQSGRSKCLKCGGSRMFYC |
| Gene ID - Mouse | ENSMUSG00000023330 |
| Gene ID - Rat | ENSRNOG00000009593 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DTWD1 pAb (ATL-HPA042214) | |
| Datasheet | Anti DTWD1 pAb (ATL-HPA042214) Datasheet (External Link) |
| Vendor Page | Anti DTWD1 pAb (ATL-HPA042214) at Atlas Antibodies |
| Documents & Links for Anti DTWD1 pAb (ATL-HPA042214) | |
| Datasheet | Anti DTWD1 pAb (ATL-HPA042214) Datasheet (External Link) |
| Vendor Page | Anti DTWD1 pAb (ATL-HPA042214) |
| Citations for Anti DTWD1 pAb (ATL-HPA042214) – 1 Found |
| Donovan, Katherine A; An, Jian; Nowak, Radosław P; Yuan, Jingting C; Fink, Emma C; Berry, Bethany C; Ebert, Benjamin L; Fischer, Eric S. Thalidomide promotes degradation of SALL4, a transcription factor implicated in Duane Radial Ray syndrome. Elife. 2018;7( 30067223) PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LCLASQEVLQKAQQSGRSKCLKCGGSRMFYC |
| Gene Sequence | LCLASQEVLQKAQQSGRSKCLKCGGSRMFYC |
| Gene ID - Mouse | ENSMUSG00000023330 |
| Gene ID - Rat | ENSRNOG00000009593 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DTWD1 pAb (ATL-HPA042214) | |
| Datasheet | Anti DTWD1 pAb (ATL-HPA042214) Datasheet (External Link) |
| Vendor Page | Anti DTWD1 pAb (ATL-HPA042214) at Atlas Antibodies |
| Documents & Links for Anti DTWD1 pAb (ATL-HPA042214) | |
| Datasheet | Anti DTWD1 pAb (ATL-HPA042214) Datasheet (External Link) |
| Vendor Page | Anti DTWD1 pAb (ATL-HPA042214) |
| Citations for Anti DTWD1 pAb (ATL-HPA042214) – 1 Found |
| Donovan, Katherine A; An, Jian; Nowak, Radosław P; Yuan, Jingting C; Fink, Emma C; Berry, Bethany C; Ebert, Benjamin L; Fischer, Eric S. Thalidomide promotes degradation of SALL4, a transcription factor implicated in Duane Radial Ray syndrome. Elife. 2018;7( 30067223) PubMed |