Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLP |
| Gene Sequence | KQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLP |
| Gene ID - Mouse | ENSMUSG00000028630 |
| Gene ID - Rat | ENSRNOG00000007821 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DYRK2 pAb (ATL-HPA027230) | |
| Datasheet | Anti DYRK2 pAb (ATL-HPA027230) Datasheet (External Link) |
| Vendor Page | Anti DYRK2 pAb (ATL-HPA027230) at Atlas Antibodies |
| Documents & Links for Anti DYRK2 pAb (ATL-HPA027230) | |
| Datasheet | Anti DYRK2 pAb (ATL-HPA027230) Datasheet (External Link) |
| Vendor Page | Anti DYRK2 pAb (ATL-HPA027230) |
| Citations for Anti DYRK2 pAb (ATL-HPA027230) – 2 Found |
| Mehnert, Martin; Ciuffa, Rodolfo; Frommelt, Fabian; Uliana, Federico; van Drogen, Audrey; Ruminski, Kilian; Gstaiger, Matthias; Aebersold, Ruedi. Multi-layered proteomic analyses decode compositional and functional effects of cancer mutations on kinase complexes. Nature Communications. 2020;11(1):3563. PubMed |
| Yoshida, Saishu; Aoki, Katsuhiko; Fujiwara, Ken; Nakakura, Takashi; Kawamura, Akira; Yamada, Kohji; Ono, Masaya; Yogosawa, Satomi; Yoshida, Kiyotsugu. The novel ciliogenesis regulator DYRK2 governs Hedgehog signaling during mouse embryogenesis. Elife. 2020;9( 32758357) PubMed |
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLP |
| Gene Sequence | KQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLP |
| Gene ID - Mouse | ENSMUSG00000028630 |
| Gene ID - Rat | ENSRNOG00000007821 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DYRK2 pAb (ATL-HPA027230) | |
| Datasheet | Anti DYRK2 pAb (ATL-HPA027230) Datasheet (External Link) |
| Vendor Page | Anti DYRK2 pAb (ATL-HPA027230) at Atlas Antibodies |
| Documents & Links for Anti DYRK2 pAb (ATL-HPA027230) | |
| Datasheet | Anti DYRK2 pAb (ATL-HPA027230) Datasheet (External Link) |
| Vendor Page | Anti DYRK2 pAb (ATL-HPA027230) |
| Citations for Anti DYRK2 pAb (ATL-HPA027230) – 2 Found |
| Mehnert, Martin; Ciuffa, Rodolfo; Frommelt, Fabian; Uliana, Federico; van Drogen, Audrey; Ruminski, Kilian; Gstaiger, Matthias; Aebersold, Ruedi. Multi-layered proteomic analyses decode compositional and functional effects of cancer mutations on kinase complexes. Nature Communications. 2020;11(1):3563. PubMed |
| Yoshida, Saishu; Aoki, Katsuhiko; Fujiwara, Ken; Nakakura, Takashi; Kawamura, Akira; Yamada, Kohji; Ono, Masaya; Yogosawa, Satomi; Yoshida, Kiyotsugu. The novel ciliogenesis regulator DYRK2 governs Hedgehog signaling during mouse embryogenesis. Elife. 2020;9( 32758357) PubMed |