Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: epidermal growth factor receptor
Gene Name: EGFR
Alternative Gene Name: ERBB, ERBB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020122: 90%, ENSRNOG00000004332: 91%
Entrez Gene ID: 1956
Uniprot ID: P00533
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	EFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIS
Gene Sequence	EFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIS
Gene ID - Mouse	ENSMUSG00000020122
Gene ID - Rat	ENSRNOG00000004332
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EGFR pAb (ATL-HPA001200 w/enhanced validation)
Datasheet	Anti EGFR pAb (ATL-HPA001200 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti EGFR pAb (ATL-HPA001200 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EGFR pAb (ATL-HPA001200 w/enhanced validation)
Datasheet	Anti EGFR pAb (ATL-HPA001200 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti EGFR pAb (ATL-HPA001200 w/enhanced validation)

Citations for Anti EGFR pAb (ATL-HPA001200 w/enhanced validation) – 2 Found

Terp, Mikkel G; Jacobsen, Kirstine; Molina, Miguel Angel; Karachaliou, Niki; Beck, Hans C; Bertran-Alamillo, Jordi; Giménez-Capitán, Ana; Cardona, Andrés F; Rosell, Rafael; Ditzel, Henrik J. Combined FGFR and Akt pathway inhibition abrogates growth of FGFR1 overexpressing EGFR-TKI-resistant NSCLC cells. Npj Precision Oncology. 2021;5(1):65. PubMed

Hudson, Elton P; Uhlen, Mathias; Rockberg, Johan. Multiplex epitope mapping using bacterial surface display reveals both linear and conformational epitopes. Scientific Reports. 2( 23050090):706. PubMed

No related products found

Reviews 0

Reviews

Anti EGFR pAb (ATL-HPA001200 w/enhanced validation)

Additional information

Specifications

Reviews 0

Anti EGFR pAb (ATL-HPA001200 w/enhanced validation)

Additional information

Specifications

No related products found

Anti EGFR pAb (ATL-HPA001200 w/enhanced validation)

Additional information

Anti EGFR pAb (ATL-HPA001200 w/enhanced validation)

Additional information

Specifications

Specifications