Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: eukaryotic translation initiation factor 2A, 65kDa
Gene Name: EIF2A
Alternative Gene Name: EIF-2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027810: 98%, ENSRNOG00000013393: 96%
Entrez Gene ID: 83939
Uniprot ID: Q9BY44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	WB, ICC, IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	VLVIASTDVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVVWNSSSTEFCAVYGFMPAKATIFNLKCDPVFDFGTGPRNA
Gene Sequence	VLVIASTDVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVVWNSSSTEFCAVYGFMPAKATIFNLKCDPVFDFGTGPRNA
Gene ID - Mouse	ENSMUSG00000027810
Gene ID - Rat	ENSRNOG00000013393
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EIF2A pAb (ATL-HPA036256)
Datasheet	Anti EIF2A pAb (ATL-HPA036256) Datasheet (External Link)
Vendor Page	Anti EIF2A pAb (ATL-HPA036256) at Atlas Antibodies

Documents & Links for Anti EIF2A pAb (ATL-HPA036256)
Datasheet	Anti EIF2A pAb (ATL-HPA036256) Datasheet (External Link)
Vendor Page	Anti EIF2A pAb (ATL-HPA036256)

Citations for Anti EIF2A pAb (ATL-HPA036256) – 1 Found

Liu, Yanbin; Zhang, Hui; Li, Xingzhi; Zhang, Changming; Huang, Haide. Identification of anti-tumoral feedback loop between VHLα and hnRNPA2B1 in renal cancer. Cell Death & Disease. 2020;11(8):688. PubMed

No related products found

Reviews 0

Reviews

Anti EIF2A pAb (ATL-HPA036256)

Additional information

Anti EIF2A pAb (ATL-HPA036256)

Additional information

Specifications

No related products found

Reviews 0

Anti EIF2A pAb (ATL-HPA036256)

Additional information

Specifications

Anti EIF2A pAb (ATL-HPA036256)

Additional information

Specifications

Specifications