Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/59544/49154/atl-hpa064885_anti-eif2s1-pab-atl-hpa064885_60742__83083.1783644954.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEVDG |
| Gene Sequence | IAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEVDG |
| Gene ID - Mouse | ENSMUSG00000021116 |
| Gene ID - Rat | ENSRNOG00000009432 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF2S1 pAb (ATL-HPA064885) | |
| Datasheet | Anti EIF2S1 pAb (ATL-HPA064885) Datasheet (External Link) |
| Vendor Page | Anti EIF2S1 pAb (ATL-HPA064885) at Atlas Antibodies |
| Documents & Links for Anti EIF2S1 pAb (ATL-HPA064885) | |
| Datasheet | Anti EIF2S1 pAb (ATL-HPA064885) Datasheet (External Link) |
| Vendor Page | Anti EIF2S1 pAb (ATL-HPA064885) |
| Citations for Anti EIF2S1 pAb (ATL-HPA064885) – 1 Found |
| Wollen, Kristian Lied; Hagen, Lars; Vågbø, Cathrine B; Rabe, Renana; Iveland, Tobias S; Aas, Per Arne; Sharma, Animesh; Sporsheim, Bjørnar; Erlandsen, Hilde O; Palibrk, Vuk; Bjørås, Magnar; Fonseca, Davi M; Mosammaparast, Nima; Slupphaug, Geir. ALKBH3 partner ASCC3 mediates P-body formation and selective clearance of MMS-induced 1-methyladenosine and 3-methylcytosine from mRNA. Journal Of Translational Medicine. 2021;19(1):287. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEVDG |
| Gene Sequence | IAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEVDG |
| Gene ID - Mouse | ENSMUSG00000021116 |
| Gene ID - Rat | ENSRNOG00000009432 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF2S1 pAb (ATL-HPA064885) | |
| Datasheet | Anti EIF2S1 pAb (ATL-HPA064885) Datasheet (External Link) |
| Vendor Page | Anti EIF2S1 pAb (ATL-HPA064885) at Atlas Antibodies |
| Documents & Links for Anti EIF2S1 pAb (ATL-HPA064885) | |
| Datasheet | Anti EIF2S1 pAb (ATL-HPA064885) Datasheet (External Link) |
| Vendor Page | Anti EIF2S1 pAb (ATL-HPA064885) |
| Citations for Anti EIF2S1 pAb (ATL-HPA064885) – 1 Found |
| Wollen, Kristian Lied; Hagen, Lars; Vågbø, Cathrine B; Rabe, Renana; Iveland, Tobias S; Aas, Per Arne; Sharma, Animesh; Sporsheim, Bjørnar; Erlandsen, Hilde O; Palibrk, Vuk; Bjørås, Magnar; Fonseca, Davi M; Mosammaparast, Nima; Slupphaug, Geir. ALKBH3 partner ASCC3 mediates P-body formation and selective clearance of MMS-induced 1-methyladenosine and 3-methylcytosine from mRNA. Journal Of Translational Medicine. 2021;19(1):287. PubMed |