Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWE |
| Gene Sequence | PPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWE |
| Gene ID - Mouse | ENSMUSG00000056076 |
| Gene ID - Rat | ENSRNOG00000001253 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF3B pAb (ATL-HPA048983) | |
| Datasheet | Anti EIF3B pAb (ATL-HPA048983) Datasheet (External Link) |
| Vendor Page | Anti EIF3B pAb (ATL-HPA048983) at Atlas Antibodies |
| Documents & Links for Anti EIF3B pAb (ATL-HPA048983) | |
| Datasheet | Anti EIF3B pAb (ATL-HPA048983) Datasheet (External Link) |
| Vendor Page | Anti EIF3B pAb (ATL-HPA048983) |
| Citations for Anti EIF3B pAb (ATL-HPA048983) – 2 Found |
| Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759. PubMed |
| van Erp, Susan; van Berkel, Annemiek A; Feenstra, Eline M; Sahoo, Pabitra K; Wagstaff, Laura J; Twiss, Jeffery L; Fawcett, James W; Eva, Richard; Ffrench-Constant, Charles. Age-related loss of axonal regeneration is reflected by the level of local translation. Experimental Neurology. 2021;339( 33450233):113594. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWE |
| Gene Sequence | PPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWE |
| Gene ID - Mouse | ENSMUSG00000056076 |
| Gene ID - Rat | ENSRNOG00000001253 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF3B pAb (ATL-HPA048983) | |
| Datasheet | Anti EIF3B pAb (ATL-HPA048983) Datasheet (External Link) |
| Vendor Page | Anti EIF3B pAb (ATL-HPA048983) at Atlas Antibodies |
| Documents & Links for Anti EIF3B pAb (ATL-HPA048983) | |
| Datasheet | Anti EIF3B pAb (ATL-HPA048983) Datasheet (External Link) |
| Vendor Page | Anti EIF3B pAb (ATL-HPA048983) |
| Citations for Anti EIF3B pAb (ATL-HPA048983) – 2 Found |
| Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759. PubMed |
| van Erp, Susan; van Berkel, Annemiek A; Feenstra, Eline M; Sahoo, Pabitra K; Wagstaff, Laura J; Twiss, Jeffery L; Fawcett, James W; Eva, Richard; Ffrench-Constant, Charles. Age-related loss of axonal regeneration is reflected by the level of local translation. Experimental Neurology. 2021;339( 33450233):113594. PubMed |