Loading...
Loading...
Loading...
Loading...
Atlas Antibodies
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/55169/42823/atl-hpa050112_anti-eif3c-pab-atl-hpa050112_54177__26960.1783640681.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTE |
| Gene Sequence | NELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTE |
| Gene ID - Mouse | ENSMUSG00000030738 |
| Gene ID - Rat | ENSRNOG00000018761 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF3C pAb (ATL-HPA050112) | |
| Datasheet | Anti EIF3C pAb (ATL-HPA050112) Datasheet (External Link) |
| Vendor Page | Anti EIF3C pAb (ATL-HPA050112) at Atlas Antibodies |
| Documents & Links for Anti EIF3C pAb (ATL-HPA050112) | |
| Datasheet | Anti EIF3C pAb (ATL-HPA050112) Datasheet (External Link) |
| Vendor Page | Anti EIF3C pAb (ATL-HPA050112) |
| Citations for Anti EIF3C pAb (ATL-HPA050112) – 1 Found |
| Zhao, Weipeng; Li, Xichuan; Wang, Jun; Wang, Chen; Jia, Yongsheng; Yuan, Shunzong; Huang, Yong; Shi, Yehui; Tong, Zhongsheng. Decreasing Eukaryotic Initiation Factor 3C (EIF3C) Suppresses Proliferation and Stimulates Apoptosis in Breast Cancer Cell Lines Through Mammalian Target of Rapamycin (mTOR) Pathway. Medical Science Monitor : International Medical Journal Of Experimental And Clinical Research. 2017;23( 28854163):4182-4191. PubMed |
No reviews have been added for this product.
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTE |
| Gene Sequence | NELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTE |
| Gene ID - Mouse | ENSMUSG00000030738 |
| Gene ID - Rat | ENSRNOG00000018761 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF3C pAb (ATL-HPA050112) | |
| Datasheet | Anti EIF3C pAb (ATL-HPA050112) Datasheet (External Link) |
| Vendor Page | Anti EIF3C pAb (ATL-HPA050112) at Atlas Antibodies |
| Documents & Links for Anti EIF3C pAb (ATL-HPA050112) | |
| Datasheet | Anti EIF3C pAb (ATL-HPA050112) Datasheet (External Link) |
| Vendor Page | Anti EIF3C pAb (ATL-HPA050112) |
| Citations for Anti EIF3C pAb (ATL-HPA050112) – 1 Found |
| Zhao, Weipeng; Li, Xichuan; Wang, Jun; Wang, Chen; Jia, Yongsheng; Yuan, Shunzong; Huang, Yong; Shi, Yehui; Tong, Zhongsheng. Decreasing Eukaryotic Initiation Factor 3C (EIF3C) Suppresses Proliferation and Stimulates Apoptosis in Breast Cancer Cell Lines Through Mammalian Target of Rapamycin (mTOR) Pathway. Medical Science Monitor : International Medical Journal Of Experimental And Clinical Research. 2017;23( 28854163):4182-4191. PubMed |