Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/47470/29417/atl-hpa029090_anti-eif5a2-pab-atl-hpa029090_40318__39138.1783631362.jpg?compression=lossy)


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/47470/29417/atl-hpa029090_anti-eif5a2-pab-atl-hpa029090_40318__39138.1783631362.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVA |
| Gene Sequence | IKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVA |
| Gene ID - Mouse | ENSMUSG00000050192 |
| Gene ID - Rat | ENSRNOG00000011859 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF5A2 pAb (ATL-HPA029090) | |
| Datasheet | Anti EIF5A2 pAb (ATL-HPA029090) Datasheet (External Link) |
| Vendor Page | Anti EIF5A2 pAb (ATL-HPA029090) at Atlas Antibodies |
| Documents & Links for Anti EIF5A2 pAb (ATL-HPA029090) | |
| Datasheet | Anti EIF5A2 pAb (ATL-HPA029090) Datasheet (External Link) |
| Vendor Page | Anti EIF5A2 pAb (ATL-HPA029090) |
| Citations for Anti EIF5A2 pAb (ATL-HPA029090) – 1 Found |
| Murata, Yoshihiko; Minami, Yuko; Iwakawa, Reika; Yokota, Jun; Usui, Shingo; Tsuta, Koji; Shiraishi, Kouya; Sakashita, Shingo; Satomi, Kaishi; Iijima, Tatsuo; Noguchi, Masayuki. ECT2 amplification and overexpression as a new prognostic biomarker for early-stage lung adenocarcinoma. Cancer Science. 2014;105(4):490-7. PubMed |


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/47470/29417/atl-hpa029090_anti-eif5a2-pab-atl-hpa029090_40318__39138.1783631362.jpg?compression=lossy)


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/47470/29417/atl-hpa029090_anti-eif5a2-pab-atl-hpa029090_40318__39138.1783631362.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVA |
| Gene Sequence | IKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVA |
| Gene ID - Mouse | ENSMUSG00000050192 |
| Gene ID - Rat | ENSRNOG00000011859 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF5A2 pAb (ATL-HPA029090) | |
| Datasheet | Anti EIF5A2 pAb (ATL-HPA029090) Datasheet (External Link) |
| Vendor Page | Anti EIF5A2 pAb (ATL-HPA029090) at Atlas Antibodies |
| Documents & Links for Anti EIF5A2 pAb (ATL-HPA029090) | |
| Datasheet | Anti EIF5A2 pAb (ATL-HPA029090) Datasheet (External Link) |
| Vendor Page | Anti EIF5A2 pAb (ATL-HPA029090) |
| Citations for Anti EIF5A2 pAb (ATL-HPA029090) – 1 Found |
| Murata, Yoshihiko; Minami, Yuko; Iwakawa, Reika; Yokota, Jun; Usui, Shingo; Tsuta, Koji; Shiraishi, Kouya; Sakashita, Shingo; Satomi, Kaishi; Iijima, Tatsuo; Noguchi, Masayuki. ECT2 amplification and overexpression as a new prognostic biomarker for early-stage lung adenocarcinoma. Cancer Science. 2014;105(4):490-7. PubMed |