Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/51526/36726/atl-hpa040873_anti-eif6-pab-atl-hpa040873-wenhanced-validation_47845__45680.1783636543.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP |
| Gene Sequence | LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP |
| Gene ID - Mouse | ENSMUSG00000027613 |
| Gene ID - Rat | ENSRNOG00000049497 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF6 pAb (ATL-HPA040873 w/enhanced validation) | |
| Datasheet | Anti EIF6 pAb (ATL-HPA040873 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EIF6 pAb (ATL-HPA040873 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti EIF6 pAb (ATL-HPA040873 w/enhanced validation) | |
| Datasheet | Anti EIF6 pAb (ATL-HPA040873 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EIF6 pAb (ATL-HPA040873 w/enhanced validation) |
| Citations for Anti EIF6 pAb (ATL-HPA040873 w/enhanced validation) – 1 Found |
| Sun, Liping; Liu, Shuguang; Wang, Xiaopai; Zheng, Xuefeng; Chen, Ya; Shen, Hong. eIF6 promotes the malignant progression of human hepatocellular carcinoma via the mTOR signaling pathway. Journal Of Translational Medicine. 2021;19(1):216. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP |
| Gene Sequence | LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP |
| Gene ID - Mouse | ENSMUSG00000027613 |
| Gene ID - Rat | ENSRNOG00000049497 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF6 pAb (ATL-HPA040873 w/enhanced validation) | |
| Datasheet | Anti EIF6 pAb (ATL-HPA040873 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EIF6 pAb (ATL-HPA040873 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti EIF6 pAb (ATL-HPA040873 w/enhanced validation) | |
| Datasheet | Anti EIF6 pAb (ATL-HPA040873 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EIF6 pAb (ATL-HPA040873 w/enhanced validation) |
| Citations for Anti EIF6 pAb (ATL-HPA040873 w/enhanced validation) – 1 Found |
| Sun, Liping; Liu, Shuguang; Wang, Xiaopai; Zheng, Xuefeng; Chen, Ya; Shen, Hong. eIF6 promotes the malignant progression of human hepatocellular carcinoma via the mTOR signaling pathway. Journal Of Translational Medicine. 2021;19(1):216. PubMed |