Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/44834/24399/atl-hpa019535_anti-elac2-pab-atl-hpa019535_35168__90082.1783627683.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WMERFGPDTQHLVLNENCASVHNLRSHKIQTQLNLIHPDIFPLLTSFRCKKEGPTLSVPMVQGECLLKYQLRPRREWQRDAIITCNPEEFIVEALQLPNFQQSVQEYR |
| Gene Sequence | WMERFGPDTQHLVLNENCASVHNLRSHKIQTQLNLIHPDIFPLLTSFRCKKEGPTLSVPMVQGECLLKYQLRPRREWQRDAIITCNPEEFIVEALQLPNFQQSVQEYR |
| Gene ID - Mouse | ENSMUSG00000020549 |
| Gene ID - Rat | ENSRNOG00000003424 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ELAC2 pAb (ATL-HPA019535) | |
| Datasheet | Anti ELAC2 pAb (ATL-HPA019535) Datasheet (External Link) |
| Vendor Page | Anti ELAC2 pAb (ATL-HPA019535) at Atlas Antibodies |
| Documents & Links for Anti ELAC2 pAb (ATL-HPA019535) | |
| Datasheet | Anti ELAC2 pAb (ATL-HPA019535) Datasheet (External Link) |
| Vendor Page | Anti ELAC2 pAb (ATL-HPA019535) |
| Citations for Anti ELAC2 pAb (ATL-HPA019535) – 2 Found |
| Schroeder, Cornelia; Navid-Hill, Elham; Meiners, Jan; Hube-Magg, Claudia; Kluth, Martina; Makrypidi-Fraune, Georgia; Simon, Ronald; Büscheck, Franziska; Luebke, Andreas M; Goebel, Cosima; Lang, Dagmar S; Weidemann, Sören; Neubauer, Emily; Hinsch, Andrea; Jacobsen, Frank; Lebok, Patrick; Michl, Uwe; Pehrke, Dirk; Huland, Hartwig; Graefen, Markus; Schlomm, Thorsten; Sauter, Guido; Höflmayer, Doris. Nuclear ELAC2 overexpression is associated with increased hazard for relapse after radical prostatectomy. Oncotarget. 2019;10(48):4973-4986. PubMed |
| Sanchez, Maria I G Lopez; Shearwood, Anne-Marie J; Chia, Tiongsun; Davies, Stefan M K; Rackham, Oliver; Filipovska, Aleksandra. Estrogen-mediated regulation of mitochondrial gene expression. Molecular Endocrinology (Baltimore, Md.). 2015;29(1):14-27. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WMERFGPDTQHLVLNENCASVHNLRSHKIQTQLNLIHPDIFPLLTSFRCKKEGPTLSVPMVQGECLLKYQLRPRREWQRDAIITCNPEEFIVEALQLPNFQQSVQEYR |
| Gene Sequence | WMERFGPDTQHLVLNENCASVHNLRSHKIQTQLNLIHPDIFPLLTSFRCKKEGPTLSVPMVQGECLLKYQLRPRREWQRDAIITCNPEEFIVEALQLPNFQQSVQEYR |
| Gene ID - Mouse | ENSMUSG00000020549 |
| Gene ID - Rat | ENSRNOG00000003424 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ELAC2 pAb (ATL-HPA019535) | |
| Datasheet | Anti ELAC2 pAb (ATL-HPA019535) Datasheet (External Link) |
| Vendor Page | Anti ELAC2 pAb (ATL-HPA019535) at Atlas Antibodies |
| Documents & Links for Anti ELAC2 pAb (ATL-HPA019535) | |
| Datasheet | Anti ELAC2 pAb (ATL-HPA019535) Datasheet (External Link) |
| Vendor Page | Anti ELAC2 pAb (ATL-HPA019535) |
| Citations for Anti ELAC2 pAb (ATL-HPA019535) – 2 Found |
| Schroeder, Cornelia; Navid-Hill, Elham; Meiners, Jan; Hube-Magg, Claudia; Kluth, Martina; Makrypidi-Fraune, Georgia; Simon, Ronald; Büscheck, Franziska; Luebke, Andreas M; Goebel, Cosima; Lang, Dagmar S; Weidemann, Sören; Neubauer, Emily; Hinsch, Andrea; Jacobsen, Frank; Lebok, Patrick; Michl, Uwe; Pehrke, Dirk; Huland, Hartwig; Graefen, Markus; Schlomm, Thorsten; Sauter, Guido; Höflmayer, Doris. Nuclear ELAC2 overexpression is associated with increased hazard for relapse after radical prostatectomy. Oncotarget. 2019;10(48):4973-4986. PubMed |
| Sanchez, Maria I G Lopez; Shearwood, Anne-Marie J; Chia, Tiongsun; Davies, Stefan M K; Rackham, Oliver; Filipovska, Aleksandra. Estrogen-mediated regulation of mitochondrial gene expression. Molecular Endocrinology (Baltimore, Md.). 2015;29(1):14-27. PubMed |