Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWK |
| Gene Sequence | GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWK |
| Gene ID - Mouse | ENSMUSG00000043460 |
| Gene ID - Rat | ENSRNOG00000007934 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ELFN2 pAb (ATL-HPA000781) | |
| Datasheet | Anti ELFN2 pAb (ATL-HPA000781) Datasheet (External Link) |
| Vendor Page | Anti ELFN2 pAb (ATL-HPA000781) at Atlas Antibodies |
| Documents & Links for Anti ELFN2 pAb (ATL-HPA000781) | |
| Datasheet | Anti ELFN2 pAb (ATL-HPA000781) Datasheet (External Link) |
| Vendor Page | Anti ELFN2 pAb (ATL-HPA000781) |
| Citations for Anti ELFN2 pAb (ATL-HPA000781) – 6 Found |
| Szoboszlay, Miklos; Kirizs, Tekla; Nusser, Zoltan. Objective quantification of nanoscale protein distributions. Scientific Reports. 2017;7(1):15240. PubMed |
| Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22. PubMed |
| Dolan, Jackie; Mitchell, Kevin J. Mutation of Elfn1 in mice causes seizures and hyperactivity. Plos One. 8(11):e80491. PubMed |
| Stachniak, Tevye Jason; Sylwestrak, Emily Lauren; Scheiffele, Peter; Hall, Benjamin J; Ghosh, Anirvan. Elfn1-Induced Constitutive Activation of mGluR7 Determines Frequency-Dependent Recruitment of Somatostatin Interneurons. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2019;39(23):4461-4474. PubMed |
| Dunn, Henry A; Zucca, Stefano; Dao, Maria; Orlandi, Cesare; Martemyanov, Kirill A. ELFN2 is a postsynaptic cell adhesion molecule with essential roles in controlling group III mGluRs in the brain and neuropsychiatric behavior. Molecular Psychiatry. 2019;24(12):1902-1919. PubMed |
| Holderith, Noemi; Aldahabi, Mohammad; Nusser, Zoltan. Selective Enrichment of Munc13-2 in Presynaptic Active Zones of Hippocampal Pyramidal Cells That Innervate mGluR1α Expressing Interneurons. Frontiers In Synaptic Neuroscience. 13( 35221979):773209. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWK |
| Gene Sequence | GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWK |
| Gene ID - Mouse | ENSMUSG00000043460 |
| Gene ID - Rat | ENSRNOG00000007934 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ELFN2 pAb (ATL-HPA000781) | |
| Datasheet | Anti ELFN2 pAb (ATL-HPA000781) Datasheet (External Link) |
| Vendor Page | Anti ELFN2 pAb (ATL-HPA000781) at Atlas Antibodies |
| Documents & Links for Anti ELFN2 pAb (ATL-HPA000781) | |
| Datasheet | Anti ELFN2 pAb (ATL-HPA000781) Datasheet (External Link) |
| Vendor Page | Anti ELFN2 pAb (ATL-HPA000781) |
| Citations for Anti ELFN2 pAb (ATL-HPA000781) – 6 Found |
| Szoboszlay, Miklos; Kirizs, Tekla; Nusser, Zoltan. Objective quantification of nanoscale protein distributions. Scientific Reports. 2017;7(1):15240. PubMed |
| Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22. PubMed |
| Dolan, Jackie; Mitchell, Kevin J. Mutation of Elfn1 in mice causes seizures and hyperactivity. Plos One. 8(11):e80491. PubMed |
| Stachniak, Tevye Jason; Sylwestrak, Emily Lauren; Scheiffele, Peter; Hall, Benjamin J; Ghosh, Anirvan. Elfn1-Induced Constitutive Activation of mGluR7 Determines Frequency-Dependent Recruitment of Somatostatin Interneurons. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2019;39(23):4461-4474. PubMed |
| Dunn, Henry A; Zucca, Stefano; Dao, Maria; Orlandi, Cesare; Martemyanov, Kirill A. ELFN2 is a postsynaptic cell adhesion molecule with essential roles in controlling group III mGluRs in the brain and neuropsychiatric behavior. Molecular Psychiatry. 2019;24(12):1902-1919. PubMed |
| Holderith, Noemi; Aldahabi, Mohammad; Nusser, Zoltan. Selective Enrichment of Munc13-2 in Presynaptic Active Zones of Hippocampal Pyramidal Cells That Innervate mGluR1α Expressing Interneurons. Frontiers In Synaptic Neuroscience. 13( 35221979):773209. PubMed |