Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTR |
| Gene Sequence | KNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTR |
| Gene ID - Mouse | ENSMUSG00000008398 |
| Gene ID - Rat | ENSRNOG00000004367 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) | |
| Datasheet | Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) | |
| Datasheet | Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) |
| Citations for Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) – 4 Found |
| Semenchenko, Kostyantyn; Wasylyk, Christine; Cheung, Henry; Tourrette, Yves; Maas, Peter; Schalken, Jack A; van der Pluijm, Gabri; Wasylyk, Bohdan. XRP44X, an Inhibitor of Ras/Erk Activation of the Transcription Factor Elk3, Inhibits Tumour Growth and Metastasis in Mice. Plos One. 11(7):e0159531. PubMed |
| Zhao, Qiuyan; Ren, Yingchun; Xie, Haoran; Yu, Lanting; Lu, Jiawei; Jiang, Weiliang; Xiao, Wenqin; Zhu, Zhonglin; Wan, Rong; Li, Baiwen. ELK3 Mediated by ZEB1 Facilitates the Growth and Metastasis of Pancreatic Carcinoma by Activating the Wnt/β-Catenin Pathway. Frontiers In Cell And Developmental Biology. 9( 34409034):700192. PubMed |
| Liu, Zhendong; Ren, Zhishuai; Zhang, Cheng; Qian, Rongjun; Wang, Hongbo; Wang, Jialin; Zhang, Wang; Liu, Binfeng; Lian, Xiaoyu; Wang, Yanbiao; Guo, Yuqi; Gao, Yanzheng. ELK3: A New Molecular Marker for the Diagnosis and Prognosis of Glioma. Frontiers In Oncology. 11( 34976781):608748. PubMed |
| Robertson, E Douglas; Wasylyk, Christine; Ye, Tao; Jung, Alain C; Wasylyk, Bohdan. The oncogenic MicroRNA Hsa-miR-155-5p targets the transcription factor ELK3 and links it to the hypoxia response. Plos One. 9(11):e113050. PubMed |






| Product Specifications | |
| Application | WB, ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTR |
| Gene Sequence | KNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTR |
| Gene ID - Mouse | ENSMUSG00000008398 |
| Gene ID - Rat | ENSRNOG00000004367 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) | |
| Datasheet | Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) | |
| Datasheet | Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) |
| Citations for Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) – 4 Found |
| Semenchenko, Kostyantyn; Wasylyk, Christine; Cheung, Henry; Tourrette, Yves; Maas, Peter; Schalken, Jack A; van der Pluijm, Gabri; Wasylyk, Bohdan. XRP44X, an Inhibitor of Ras/Erk Activation of the Transcription Factor Elk3, Inhibits Tumour Growth and Metastasis in Mice. Plos One. 11(7):e0159531. PubMed |
| Zhao, Qiuyan; Ren, Yingchun; Xie, Haoran; Yu, Lanting; Lu, Jiawei; Jiang, Weiliang; Xiao, Wenqin; Zhu, Zhonglin; Wan, Rong; Li, Baiwen. ELK3 Mediated by ZEB1 Facilitates the Growth and Metastasis of Pancreatic Carcinoma by Activating the Wnt/β-Catenin Pathway. Frontiers In Cell And Developmental Biology. 9( 34409034):700192. PubMed |
| Liu, Zhendong; Ren, Zhishuai; Zhang, Cheng; Qian, Rongjun; Wang, Hongbo; Wang, Jialin; Zhang, Wang; Liu, Binfeng; Lian, Xiaoyu; Wang, Yanbiao; Guo, Yuqi; Gao, Yanzheng. ELK3: A New Molecular Marker for the Diagnosis and Prognosis of Glioma. Frontiers In Oncology. 11( 34976781):608748. PubMed |
| Robertson, E Douglas; Wasylyk, Christine; Ye, Tao; Jung, Alain C; Wasylyk, Bohdan. The oncogenic MicroRNA Hsa-miR-155-5p targets the transcription factor ELK3 and links it to the hypoxia response. Plos One. 9(11):e113050. PubMed |