Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGA |
| Gene Sequence | VKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGA |
| Gene ID - Mouse | ENSMUSG00000029675 |
| Gene ID - Rat | ENSRNOG00000001469 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ELN pAb (ATL-HPA018111) | |
| Datasheet | Anti ELN pAb (ATL-HPA018111) Datasheet (External Link) |
| Vendor Page | Anti ELN pAb (ATL-HPA018111) at Atlas Antibodies |
| Documents & Links for Anti ELN pAb (ATL-HPA018111) | |
| Datasheet | Anti ELN pAb (ATL-HPA018111) Datasheet (External Link) |
| Vendor Page | Anti ELN pAb (ATL-HPA018111) |
| Citations for Anti ELN pAb (ATL-HPA018111) – 3 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Votteler, Miriam; Berrio, Daniel A Carvajal; Horke, Alexander; Sabatier, Laetitia; Reinhardt, Dieter P; Nsair, Ali; Aikawa, Elena; Schenke-Layland, Katja. Elastogenesis at the onset of human cardiac valve development. Development (Cambridge, England). 2013;140(11):2345-53. PubMed |
| Sun, Qinxue; Baues, Maike; Klinkhammer, Barbara M; Ehling, Josef; Djudjaj, Sonja; Drude, Natascha I; Daniel, Christoph; Amann, Kerstin; Kramann, Rafael; Kim, Hyojin; Saez-Rodriguez, Julio; Weiskirchen, Ralf; Onthank, David C; Botnar, Rene M; Kiessling, Fabian; Floege, Jürgen; Lammers, Twan; Boor, Peter. Elastin imaging enables noninvasive staging and treatment monitoring of kidney fibrosis. Science Translational Medicine. 2019;11(486) PubMed |


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGA |
| Gene Sequence | VKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGA |
| Gene ID - Mouse | ENSMUSG00000029675 |
| Gene ID - Rat | ENSRNOG00000001469 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ELN pAb (ATL-HPA018111) | |
| Datasheet | Anti ELN pAb (ATL-HPA018111) Datasheet (External Link) |
| Vendor Page | Anti ELN pAb (ATL-HPA018111) at Atlas Antibodies |
| Documents & Links for Anti ELN pAb (ATL-HPA018111) | |
| Datasheet | Anti ELN pAb (ATL-HPA018111) Datasheet (External Link) |
| Vendor Page | Anti ELN pAb (ATL-HPA018111) |
| Citations for Anti ELN pAb (ATL-HPA018111) – 3 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Votteler, Miriam; Berrio, Daniel A Carvajal; Horke, Alexander; Sabatier, Laetitia; Reinhardt, Dieter P; Nsair, Ali; Aikawa, Elena; Schenke-Layland, Katja. Elastogenesis at the onset of human cardiac valve development. Development (Cambridge, England). 2013;140(11):2345-53. PubMed |
| Sun, Qinxue; Baues, Maike; Klinkhammer, Barbara M; Ehling, Josef; Djudjaj, Sonja; Drude, Natascha I; Daniel, Christoph; Amann, Kerstin; Kramann, Rafael; Kim, Hyojin; Saez-Rodriguez, Julio; Weiskirchen, Ralf; Onthank, David C; Botnar, Rene M; Kiessling, Fabian; Floege, Jürgen; Lammers, Twan; Boor, Peter. Elastin imaging enables noninvasive staging and treatment monitoring of kidney fibrosis. Science Translational Medicine. 2019;11(486) PubMed |