Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45768/26252/atl-hpa023279_anti-elp5-pab-atl-hpa023279_37071__74064.1783629053.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GTGRELEMLDSLLALGGLVLLRDSVEWEGRSLLKALVKKSALCGEQVHILGCEVSEEEFREGFDSDINNRL |
| Gene Sequence | GTGRELEMLDSLLALGGLVLLRDSVEWEGRSLLKALVKKSALCGEQVHILGCEVSEEEFREGFDSDINNRL |
| Gene ID - Mouse | ENSMUSG00000018565 |
| Gene ID - Rat | ENSRNOG00000027628 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ELP5 pAb (ATL-HPA023279) | |
| Datasheet | Anti ELP5 pAb (ATL-HPA023279) Datasheet (External Link) |
| Vendor Page | Anti ELP5 pAb (ATL-HPA023279) at Atlas Antibodies |
| Documents & Links for Anti ELP5 pAb (ATL-HPA023279) | |
| Datasheet | Anti ELP5 pAb (ATL-HPA023279) Datasheet (External Link) |
| Vendor Page | Anti ELP5 pAb (ATL-HPA023279) |
| Citations for Anti ELP5 pAb (ATL-HPA023279) – 2 Found |
| Xu, Sunwang; Jiang, Cen; Lin, Ruirong; Wang, Xiaopeng; Hu, Xiaoqiang; Chen, Wei; Chen, Xiangjin; Chen, Tao. Epigenetic activation of the elongator complex sensitizes gallbladder cancer to gemcitabine therapy. Journal Of Experimental & Clinical Cancer Research : Cr. 2021;40(1):373. PubMed |
| Xu, Sunwang; Zhan, Ming; Jiang, Cen; He, Min; Yang, Linhua; Shen, Hui; Huang, Shuai; Huang, Xince; Lin, Ruirong; Shi, Yongheng; Liu, Qiang; Chen, Wei; Mohan, Man; Wang, Jian. Genome-wide CRISPR screen identifies ELP5 as a determinant of gemcitabine sensitivity in gallbladder cancer. Nature Communications. 2019;10(1):5492. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GTGRELEMLDSLLALGGLVLLRDSVEWEGRSLLKALVKKSALCGEQVHILGCEVSEEEFREGFDSDINNRL |
| Gene Sequence | GTGRELEMLDSLLALGGLVLLRDSVEWEGRSLLKALVKKSALCGEQVHILGCEVSEEEFREGFDSDINNRL |
| Gene ID - Mouse | ENSMUSG00000018565 |
| Gene ID - Rat | ENSRNOG00000027628 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ELP5 pAb (ATL-HPA023279) | |
| Datasheet | Anti ELP5 pAb (ATL-HPA023279) Datasheet (External Link) |
| Vendor Page | Anti ELP5 pAb (ATL-HPA023279) at Atlas Antibodies |
| Documents & Links for Anti ELP5 pAb (ATL-HPA023279) | |
| Datasheet | Anti ELP5 pAb (ATL-HPA023279) Datasheet (External Link) |
| Vendor Page | Anti ELP5 pAb (ATL-HPA023279) |
| Citations for Anti ELP5 pAb (ATL-HPA023279) – 2 Found |
| Xu, Sunwang; Jiang, Cen; Lin, Ruirong; Wang, Xiaopeng; Hu, Xiaoqiang; Chen, Wei; Chen, Xiangjin; Chen, Tao. Epigenetic activation of the elongator complex sensitizes gallbladder cancer to gemcitabine therapy. Journal Of Experimental & Clinical Cancer Research : Cr. 2021;40(1):373. PubMed |
| Xu, Sunwang; Zhan, Ming; Jiang, Cen; He, Min; Yang, Linhua; Shen, Hui; Huang, Shuai; Huang, Xince; Lin, Ruirong; Shi, Yongheng; Liu, Qiang; Chen, Wei; Mohan, Man; Wang, Jian. Genome-wide CRISPR screen identifies ELP5 as a determinant of gemcitabine sensitivity in gallbladder cancer. Nature Communications. 2019;10(1):5492. PubMed |