Loading...
Loading...
Loading...
Loading...
Atlas Antibodies

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/58692/47978/atl-hpa061711_anti-hk2-pab-atl-hpa061711_59532__48958.1783644175.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/58692/47978/atl-hpa061711_anti-hk2-pab-atl-hpa061711_59532__48958.1783644175.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ADQHRARQKTLEHLQLSHDQLLEVKRRMKVEMERGLSKETHASAPVKMLPT |
| Gene Sequence | ADQHRARQKTLEHLQLSHDQLLEVKRRMKVEMERGLSKETHASAPVKMLPT |
| Gene ID - Mouse | ENSMUSG00000000628 |
| Gene ID - Rat | ENSRNOG00000006116 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HK2 pAb (ATL-HPA061711) | |
| Datasheet | Anti HK2 pAb (ATL-HPA061711) Datasheet (External Link) |
| Vendor Page | Anti HK2 pAb (ATL-HPA061711) at Atlas Antibodies |
| Documents & Links for Anti HK2 pAb (ATL-HPA061711) | |
| Datasheet | Anti HK2 pAb (ATL-HPA061711) Datasheet (External Link) |
| Vendor Page | Anti HK2 pAb (ATL-HPA061711) |
No reviews have been added for this product.
Try browsing our complete catalog of products.
Atlas Antibodies

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/58692/47978/atl-hpa061711_anti-hk2-pab-atl-hpa061711_59532__48958.1783644175.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/58692/47978/atl-hpa061711_anti-hk2-pab-atl-hpa061711_59532__48958.1783644175.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ADQHRARQKTLEHLQLSHDQLLEVKRRMKVEMERGLSKETHASAPVKMLPT |
| Gene Sequence | ADQHRARQKTLEHLQLSHDQLLEVKRRMKVEMERGLSKETHASAPVKMLPT |
| Gene ID - Mouse | ENSMUSG00000000628 |
| Gene ID - Rat | ENSRNOG00000006116 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HK2 pAb (ATL-HPA061711) | |
| Datasheet | Anti HK2 pAb (ATL-HPA061711) Datasheet (External Link) |
| Vendor Page | Anti HK2 pAb (ATL-HPA061711) at Atlas Antibodies |
| Documents & Links for Anti HK2 pAb (ATL-HPA061711) | |
| Datasheet | Anti HK2 pAb (ATL-HPA061711) Datasheet (External Link) |
| Vendor Page | Anti HK2 pAb (ATL-HPA061711) |