Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPM |
| Gene Sequence | DENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPM |
| Gene ID - Mouse | ENSMUSG00000041607 |
| Gene ID - Rat | ENSRNOG00000016516 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MBP pAb (ATL-HPA049222) | |
| Datasheet | Anti MBP pAb (ATL-HPA049222) Datasheet (External Link) |
| Vendor Page | Anti MBP pAb (ATL-HPA049222) at Atlas Antibodies |
| Documents & Links for Anti MBP pAb (ATL-HPA049222) | |
| Datasheet | Anti MBP pAb (ATL-HPA049222) Datasheet (External Link) |
| Vendor Page | Anti MBP pAb (ATL-HPA049222) |
| Citations for Anti MBP pAb (ATL-HPA049222) – 2 Found |
| Bergström, Sofia; Öijerstedt, Linn; Remnestål, Julia; Olofsson, Jennie; Ullgren, Abbe; Seelaar, Harro; van Swieten, John C; Synofzik, Matthis; Sanchez-Valle, Raquel; Moreno, Fermin; Finger, Elizabeth; Masellis, Mario; Tartaglia, Carmela; Vandenberghe, Rik; Laforce, Robert; Galimberti, Daniela; Borroni, Barbara; Butler, Chris R; Gerhard, Alexander; Ducharme, Simon; Rohrer, Jonathan D; Månberg, Anna; Graff, Caroline; Nilsson, Peter. A panel of CSF proteins separates genetic frontotemporal dementia from presymptomatic mutation carriers: a GENFI study. Molecular Neurodegeneration. 2021;16(1):79. PubMed |
| Gao, Yanpan; Liu, Jiaqi; Wang, Jiayu; Liu, Yifan; Zeng, Ling-Hui; Ge, Wei; Ma, Chao. Proteomic analysis of human hippocampal subfields provides new insights into the pathogenesis of Alzheimer's disease and the role of glial cells. Brain Pathology (Zurich, Switzerland). 2022;32(4):e13047. PubMed |




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPM |
| Gene Sequence | DENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPM |
| Gene ID - Mouse | ENSMUSG00000041607 |
| Gene ID - Rat | ENSRNOG00000016516 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MBP pAb (ATL-HPA049222) | |
| Datasheet | Anti MBP pAb (ATL-HPA049222) Datasheet (External Link) |
| Vendor Page | Anti MBP pAb (ATL-HPA049222) at Atlas Antibodies |
| Documents & Links for Anti MBP pAb (ATL-HPA049222) | |
| Datasheet | Anti MBP pAb (ATL-HPA049222) Datasheet (External Link) |
| Vendor Page | Anti MBP pAb (ATL-HPA049222) |
| Citations for Anti MBP pAb (ATL-HPA049222) – 2 Found |
| Bergström, Sofia; Öijerstedt, Linn; Remnestål, Julia; Olofsson, Jennie; Ullgren, Abbe; Seelaar, Harro; van Swieten, John C; Synofzik, Matthis; Sanchez-Valle, Raquel; Moreno, Fermin; Finger, Elizabeth; Masellis, Mario; Tartaglia, Carmela; Vandenberghe, Rik; Laforce, Robert; Galimberti, Daniela; Borroni, Barbara; Butler, Chris R; Gerhard, Alexander; Ducharme, Simon; Rohrer, Jonathan D; Månberg, Anna; Graff, Caroline; Nilsson, Peter. A panel of CSF proteins separates genetic frontotemporal dementia from presymptomatic mutation carriers: a GENFI study. Molecular Neurodegeneration. 2021;16(1):79. PubMed |
| Gao, Yanpan; Liu, Jiaqi; Wang, Jiayu; Liu, Yifan; Zeng, Ling-Hui; Ge, Wei; Ma, Chao. Proteomic analysis of human hippocampal subfields provides new insights into the pathogenesis of Alzheimer's disease and the role of glial cells. Brain Pathology (Zurich, Switzerland). 2022;32(4):e13047. PubMed |