Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN |
| Gene Sequence | PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN |
| Gene ID - Mouse | ENSMUSG00000005583 |
| Gene ID - Rat | ENSRNOG00000033134 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MEF2C pAb (ATL-HPA005533 w/enhanced validation) | |
| Datasheet | Anti MEF2C pAb (ATL-HPA005533 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MEF2C pAb (ATL-HPA005533 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MEF2C pAb (ATL-HPA005533 w/enhanced validation) | |
| Datasheet | Anti MEF2C pAb (ATL-HPA005533 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MEF2C pAb (ATL-HPA005533 w/enhanced validation) |
| Citations for Anti MEF2C pAb (ATL-HPA005533 w/enhanced validation) – 8 Found |
| Mifflin, Joshua J; Dupuis, Loren E; Alcala, Nicolas E; Russell, Lea G; Kern, Christine B. Intercalated cushion cells within the cardiac outflow tract are derived from the myocardial troponin T type 2 (Tnnt2) Cre lineage. Developmental Dynamics : An Official Publication Of The American Association Of Anatomists. 2018;247(8):1005-1017. PubMed |
| Guo, Dongsheng; Daman, Katelyn; Chen, Jennifer Jc; Shi, Meng-Jiao; Yan, Jing; Matijasevic, Zdenka; Rickard, Amanda M; Bennett, Monica H; Kiselyov, Alex; Zhou, Haowen; Bang, Anne G; Wagner, Kathryn R; Maehr, René; King, Oliver D; Hayward, Lawrence J; Emerson, Charles P Jr. iMyoblasts for ex vivo and in vivo investigations of human myogenesis and disease modeling. Elife. 2022;11( 35076017) PubMed |
| Wirrig, Elaine E; Hinton, Robert B; Yutzey, Katherine E. Differential expression of cartilage and bone-related proteins in pediatric and adult diseased aortic valves. Journal Of Molecular And Cellular Cardiology. 2011;50(3):561-9. PubMed |
| Yelamanchili, S V; Chaudhuri, A Datta; Chen, L-N; Xiong, Huangui; Fox, H S. MicroRNA-21 dysregulates the expression of MEF2C in neurons in monkey and human SIV/HIV neurological disease. Cell Death & Disease. 1(9):e77. PubMed |
| Clark, Christopher D; Zhang, Boding; Lee, Benjamin; Evans, Samuel I; Lassar, Andrew B; Lee, Kyu-Ho. Evolutionary conservation of Nkx2.5 autoregulation in the second heart field. Developmental Biology. 2013;374(1):198-209. PubMed |
| Lockhart, Marie M; Wirrig, Elaine E; Phelps, Aimee L; Ghatnekar, Angela V; Barth, Jeremy L; Norris, Russell A; Wessels, Andy. Mef2c regulates transcription of the extracellular matrix protein cartilage link protein 1 in the developing murine heart. Plos One. 8(2):e57073. PubMed |
| Rosebrock, Daniel; Arora, Sneha; Mutukula, Naresh; Volkman, Rotem; Gralinska, Elzbieta; Balaskas, Anastasios; Aragonés Hernández, Amèlia; Buschow, René; Brändl, Björn; Müller, Franz-Josef; Arndt, Peter F; Vingron, Martin; Elkabetz, Yechiel. Enhanced cortical neural stem cell identity through short SMAD and WNT inhibition in human cerebral organoids facilitates emergence of outer radial glial cells. Nature Cell Biology. 2022;24(6):981-995. PubMed |
| Clark, Christopher D; Lee, Kyu-Ho. Second heart field-specific expression of Nkx2-5 requires promoter proximal interaction with Srf. Mechanisms Of Development. 2020;162( 32450132):103615. PubMed |






| Product Specifications | |
| Application | WB, ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN |
| Gene Sequence | PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN |
| Gene ID - Mouse | ENSMUSG00000005583 |
| Gene ID - Rat | ENSRNOG00000033134 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MEF2C pAb (ATL-HPA005533 w/enhanced validation) | |
| Datasheet | Anti MEF2C pAb (ATL-HPA005533 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MEF2C pAb (ATL-HPA005533 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MEF2C pAb (ATL-HPA005533 w/enhanced validation) | |
| Datasheet | Anti MEF2C pAb (ATL-HPA005533 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MEF2C pAb (ATL-HPA005533 w/enhanced validation) |
| Citations for Anti MEF2C pAb (ATL-HPA005533 w/enhanced validation) – 8 Found |
| Mifflin, Joshua J; Dupuis, Loren E; Alcala, Nicolas E; Russell, Lea G; Kern, Christine B. Intercalated cushion cells within the cardiac outflow tract are derived from the myocardial troponin T type 2 (Tnnt2) Cre lineage. Developmental Dynamics : An Official Publication Of The American Association Of Anatomists. 2018;247(8):1005-1017. PubMed |
| Guo, Dongsheng; Daman, Katelyn; Chen, Jennifer Jc; Shi, Meng-Jiao; Yan, Jing; Matijasevic, Zdenka; Rickard, Amanda M; Bennett, Monica H; Kiselyov, Alex; Zhou, Haowen; Bang, Anne G; Wagner, Kathryn R; Maehr, René; King, Oliver D; Hayward, Lawrence J; Emerson, Charles P Jr. iMyoblasts for ex vivo and in vivo investigations of human myogenesis and disease modeling. Elife. 2022;11( 35076017) PubMed |
| Wirrig, Elaine E; Hinton, Robert B; Yutzey, Katherine E. Differential expression of cartilage and bone-related proteins in pediatric and adult diseased aortic valves. Journal Of Molecular And Cellular Cardiology. 2011;50(3):561-9. PubMed |
| Yelamanchili, S V; Chaudhuri, A Datta; Chen, L-N; Xiong, Huangui; Fox, H S. MicroRNA-21 dysregulates the expression of MEF2C in neurons in monkey and human SIV/HIV neurological disease. Cell Death & Disease. 1(9):e77. PubMed |
| Clark, Christopher D; Zhang, Boding; Lee, Benjamin; Evans, Samuel I; Lassar, Andrew B; Lee, Kyu-Ho. Evolutionary conservation of Nkx2.5 autoregulation in the second heart field. Developmental Biology. 2013;374(1):198-209. PubMed |
| Lockhart, Marie M; Wirrig, Elaine E; Phelps, Aimee L; Ghatnekar, Angela V; Barth, Jeremy L; Norris, Russell A; Wessels, Andy. Mef2c regulates transcription of the extracellular matrix protein cartilage link protein 1 in the developing murine heart. Plos One. 8(2):e57073. PubMed |
| Rosebrock, Daniel; Arora, Sneha; Mutukula, Naresh; Volkman, Rotem; Gralinska, Elzbieta; Balaskas, Anastasios; Aragonés Hernández, Amèlia; Buschow, René; Brändl, Björn; Müller, Franz-Josef; Arndt, Peter F; Vingron, Martin; Elkabetz, Yechiel. Enhanced cortical neural stem cell identity through short SMAD and WNT inhibition in human cerebral organoids facilitates emergence of outer radial glial cells. Nature Cell Biology. 2022;24(6):981-995. PubMed |
| Clark, Christopher D; Lee, Kyu-Ho. Second heart field-specific expression of Nkx2-5 requires promoter proximal interaction with Srf. Mechanisms Of Development. 2020;162( 32450132):103615. PubMed |