Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWT |
| Gene Sequence | ILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWT |
| Gene ID - Mouse | ENSMUSG00000031173 |
| Gene ID - Rat | ENSRNOG00000003370 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OTC pAb (ATL-HPA000243 w/enhanced validation) | |
| Datasheet | Anti OTC pAb (ATL-HPA000243 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OTC pAb (ATL-HPA000243 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti OTC pAb (ATL-HPA000243 w/enhanced validation) | |
| Datasheet | Anti OTC pAb (ATL-HPA000243 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OTC pAb (ATL-HPA000243 w/enhanced validation) |
| Citations for Anti OTC pAb (ATL-HPA000243 w/enhanced validation) – 5 Found |
| Herrero, Astrid; Prigent, Julie; Lombard, Catherine; Rosseels, Valérie; Daujat-Chavanieu, Martine; Breckpot, Karine; Najimi, Mustapha; Deblandre, Gisèle; Sokal, Etienne M. Adult-Derived Human Liver Stem/Progenitor Cells Infused 3 Days Postsurgery Improve Liver Regeneration in a Mouse Model of Extended Hepatectomy. Cell Transplantation. 2017;26(2):351-364. PubMed |
| Zabulica, Mihaela; Srinivasan, Raghuraman C; Akcakaya, Pinar; Allegri, Gabriella; Bestas, Burcu; Firth, Mike; Hammarstedt, Christina; Jakobsson, Tomas; Jakobsson, Towe; Ellis, Ewa; Jorns, Carl; Makris, Georgios; Scherer, Tanja; Rimann, Nicole; van Zuydam, Natalie R; Gramignoli, Roberto; Forslöw, Anna; Engberg, Susanna; Maresca, Marcello; Rooyackers, Olav; Thöny, Beat; Häberle, Johannes; Rosen, Barry; Strom, Stephen C. Correction of a urea cycle defect after ex vivo gene editing of human hepatocytes. Molecular Therapy : The Journal Of The American Society Of Gene Therapy. 2021;29(5):1903-1917. PubMed |
| Chaerkady, Raghothama; Harsha, H C; Nalli, Anuradha; Gucek, Marjan; Vivekanandan, Perumal; Akhtar, Javed; Cole, Robert N; Simmers, Jessica; Schulick, Richard D; Singh, Sujay; Torbenson, Michael; Pandey, Akhilesh; Thuluvath, Paul J. A quantitative proteomic approach for identification of potential biomarkers in hepatocellular carcinoma. Journal Of Proteome Research. 2008;7(10):4289-98. PubMed |
| Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17. PubMed |
| Ginn, Samantha L; Amaya, Anais K; Liao, Sophia H Y; Zhu, Erhua; Cunningham, Sharon C; Lee, Michael; Hallwirth, Claus V; Logan, Grant J; Tay, Szun S; Cesare, Anthony J; Pickett, Hilda A; Grompe, Markus; Dilworth, Kimberley; Lisowski, Leszek; Alexander, Ian E. Efficient in vivo editing of OTC-deficient patient-derived primary human hepatocytes. Jhep Reports : Innovation In Hepatology. 2020;2(1):100065. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWT |
| Gene Sequence | ILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWT |
| Gene ID - Mouse | ENSMUSG00000031173 |
| Gene ID - Rat | ENSRNOG00000003370 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OTC pAb (ATL-HPA000243 w/enhanced validation) | |
| Datasheet | Anti OTC pAb (ATL-HPA000243 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OTC pAb (ATL-HPA000243 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti OTC pAb (ATL-HPA000243 w/enhanced validation) | |
| Datasheet | Anti OTC pAb (ATL-HPA000243 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OTC pAb (ATL-HPA000243 w/enhanced validation) |
| Citations for Anti OTC pAb (ATL-HPA000243 w/enhanced validation) – 5 Found |
| Herrero, Astrid; Prigent, Julie; Lombard, Catherine; Rosseels, Valérie; Daujat-Chavanieu, Martine; Breckpot, Karine; Najimi, Mustapha; Deblandre, Gisèle; Sokal, Etienne M. Adult-Derived Human Liver Stem/Progenitor Cells Infused 3 Days Postsurgery Improve Liver Regeneration in a Mouse Model of Extended Hepatectomy. Cell Transplantation. 2017;26(2):351-364. PubMed |
| Zabulica, Mihaela; Srinivasan, Raghuraman C; Akcakaya, Pinar; Allegri, Gabriella; Bestas, Burcu; Firth, Mike; Hammarstedt, Christina; Jakobsson, Tomas; Jakobsson, Towe; Ellis, Ewa; Jorns, Carl; Makris, Georgios; Scherer, Tanja; Rimann, Nicole; van Zuydam, Natalie R; Gramignoli, Roberto; Forslöw, Anna; Engberg, Susanna; Maresca, Marcello; Rooyackers, Olav; Thöny, Beat; Häberle, Johannes; Rosen, Barry; Strom, Stephen C. Correction of a urea cycle defect after ex vivo gene editing of human hepatocytes. Molecular Therapy : The Journal Of The American Society Of Gene Therapy. 2021;29(5):1903-1917. PubMed |
| Chaerkady, Raghothama; Harsha, H C; Nalli, Anuradha; Gucek, Marjan; Vivekanandan, Perumal; Akhtar, Javed; Cole, Robert N; Simmers, Jessica; Schulick, Richard D; Singh, Sujay; Torbenson, Michael; Pandey, Akhilesh; Thuluvath, Paul J. A quantitative proteomic approach for identification of potential biomarkers in hepatocellular carcinoma. Journal Of Proteome Research. 2008;7(10):4289-98. PubMed |
| Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17. PubMed |
| Ginn, Samantha L; Amaya, Anais K; Liao, Sophia H Y; Zhu, Erhua; Cunningham, Sharon C; Lee, Michael; Hallwirth, Claus V; Logan, Grant J; Tay, Szun S; Cesare, Anthony J; Pickett, Hilda A; Grompe, Markus; Dilworth, Kimberley; Lisowski, Leszek; Alexander, Ian E. Efficient in vivo editing of OTC-deficient patient-derived primary human hepatocytes. Jhep Reports : Innovation In Hepatology. 2020;2(1):100065. PubMed |