Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRD |
| Gene Sequence | FERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRD |
| Gene ID - Mouse | ENSMUSG00000004231 |
| Gene ID - Rat | ENSRNOG00000014253 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) | |
| Datasheet | Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) | |
| Datasheet | Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) |
| Citations for Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) – 2 Found |
| Larsson, Max. Non-canonical heterogeneous cellular distribution and co-localization of CaMKIIα and CaMKIIβ in the spinal superficial dorsal horn. Brain Structure & Function. 2018;223(3):1437-1457. PubMed |
| Gutierrez-Mecinas, Maria; Bell, Andrew; Polgár, Erika; Watanabe, Masahiko; Todd, Andrew J. Expression of Neuropeptide FF Defines a Population of Excitatory Interneurons in the Superficial Dorsal Horn of the Mouse Spinal Cord that Respond to Noxious and Pruritic Stimuli. Neuroscience. 2019;416( 31421202):281-293. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRD |
| Gene Sequence | FERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRD |
| Gene ID - Mouse | ENSMUSG00000004231 |
| Gene ID - Rat | ENSRNOG00000014253 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) | |
| Datasheet | Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) | |
| Datasheet | Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) |
| Citations for Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) – 2 Found |
| Larsson, Max. Non-canonical heterogeneous cellular distribution and co-localization of CaMKIIα and CaMKIIβ in the spinal superficial dorsal horn. Brain Structure & Function. 2018;223(3):1437-1457. PubMed |
| Gutierrez-Mecinas, Maria; Bell, Andrew; Polgár, Erika; Watanabe, Masahiko; Todd, Andrew J. Expression of Neuropeptide FF Defines a Population of Excitatory Interneurons in the Superficial Dorsal Horn of the Mouse Spinal Cord that Respond to Noxious and Pruritic Stimuli. Neuroscience. 2019;416( 31421202):281-293. PubMed |