Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG |
| Gene Sequence | EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG |
| Gene ID - Mouse | ENSMUSG00000026572 |
| Gene ID - Rat | ENSRNOG00000025634 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TBX19 pAb (ATL-HPA072686) | |
| Datasheet | Anti TBX19 pAb (ATL-HPA072686) Datasheet (External Link) |
| Vendor Page | Anti TBX19 pAb (ATL-HPA072686) at Atlas Antibodies |
| Documents & Links for Anti TBX19 pAb (ATL-HPA072686) | |
| Datasheet | Anti TBX19 pAb (ATL-HPA072686) Datasheet (External Link) |
| Vendor Page | Anti TBX19 pAb (ATL-HPA072686) |
| Citations for Anti TBX19 pAb (ATL-HPA072686) – 5 Found |
| Sjöstedt, Evelina; Bollerslev, Jens; Mulder, Jan; Lindskog, Cecilia; Pontén, Fredrik; Casar-Borota, Olivera. A specific antibody to detect transcription factor T-Pit: a reliable marker of corticotroph cell differentiation and a tool to improve the classification of pituitary neuroendocrine tumours. Acta Neuropathologica. 2017;134(4):675-677. PubMed |
| Uraki, Shinsuke; Ariyasu, Hiroyuki; Doi, Asako; Takeshima, Ken; Morita, Shuhei; Inaba, Hidefumi; Furuta, Hiroto; Fukuhara, Noriaki; Inoshita, Naoko; Nishioka, Hiroshi; Nakao, Naoyuki; Yamada, Shozo; Akamizu, Takashi. MSH6/2 and PD-L1 Expressions Are Associated with Tumor Growth and Invasiveness in Silent Pituitary Adenoma Subtypes. International Journal Of Molecular Sciences. 2020;21(8) PubMed |
| Peculis, Raitis; Mandrika, Ilona; Petrovska, Ramona; Dortane, Rasma; Megnis, Kaspars; Nazarovs, Jurijs; Balcere, Inga; Stukens, Janis; Konrade, Ilze; Pirags, Valdis; Klovins, Janis; Rovite, Vita. Pituispheres Contain Genetic Variants Characteristic to Pituitary Adenoma Tumor Tissue. Frontiers In Endocrinology. 11( 32528411):313. PubMed |
| Sjöstedt, Evelina; Kolnes, Anders J; Olarescu, Nicoleta C; Mitsios, Nicholas; Hikmet, Feria; Sivertsson, Åsa; Lindskog, Cecilia; Øystese, Kristin A B; Jørgensen, Anders P; Bollerslev, Jens; Casar-Borota, Olivera. TGFBR3L-An Uncharacterised Pituitary Specific Membrane Protein Detected in the Gonadotroph Cells in Non-Neoplastic and Tumour Tissue. Cancers. 2020;13(1) PubMed |
| Hallén, Tobias; Johannsson, Gudmundur; Dahlén, Rahil; Glad, Camilla A M; Örndal, Charlotte; Engvall, Angelica; Carén, Helena; Skoglund, Thomas; Olsson, Daniel S. Genome-wide DNA Methylation Differences in Nonfunctioning Pituitary Adenomas With and Without Postsurgical Progression. The Journal Of Clinical Endocrinology And Metabolism. 2022;107(8):2318-2328. PubMed |
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG |
| Gene Sequence | EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG |
| Gene ID - Mouse | ENSMUSG00000026572 |
| Gene ID - Rat | ENSRNOG00000025634 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TBX19 pAb (ATL-HPA072686) | |
| Datasheet | Anti TBX19 pAb (ATL-HPA072686) Datasheet (External Link) |
| Vendor Page | Anti TBX19 pAb (ATL-HPA072686) at Atlas Antibodies |
| Documents & Links for Anti TBX19 pAb (ATL-HPA072686) | |
| Datasheet | Anti TBX19 pAb (ATL-HPA072686) Datasheet (External Link) |
| Vendor Page | Anti TBX19 pAb (ATL-HPA072686) |
| Citations for Anti TBX19 pAb (ATL-HPA072686) – 5 Found |
| Sjöstedt, Evelina; Bollerslev, Jens; Mulder, Jan; Lindskog, Cecilia; Pontén, Fredrik; Casar-Borota, Olivera. A specific antibody to detect transcription factor T-Pit: a reliable marker of corticotroph cell differentiation and a tool to improve the classification of pituitary neuroendocrine tumours. Acta Neuropathologica. 2017;134(4):675-677. PubMed |
| Uraki, Shinsuke; Ariyasu, Hiroyuki; Doi, Asako; Takeshima, Ken; Morita, Shuhei; Inaba, Hidefumi; Furuta, Hiroto; Fukuhara, Noriaki; Inoshita, Naoko; Nishioka, Hiroshi; Nakao, Naoyuki; Yamada, Shozo; Akamizu, Takashi. MSH6/2 and PD-L1 Expressions Are Associated with Tumor Growth and Invasiveness in Silent Pituitary Adenoma Subtypes. International Journal Of Molecular Sciences. 2020;21(8) PubMed |
| Peculis, Raitis; Mandrika, Ilona; Petrovska, Ramona; Dortane, Rasma; Megnis, Kaspars; Nazarovs, Jurijs; Balcere, Inga; Stukens, Janis; Konrade, Ilze; Pirags, Valdis; Klovins, Janis; Rovite, Vita. Pituispheres Contain Genetic Variants Characteristic to Pituitary Adenoma Tumor Tissue. Frontiers In Endocrinology. 11( 32528411):313. PubMed |
| Sjöstedt, Evelina; Kolnes, Anders J; Olarescu, Nicoleta C; Mitsios, Nicholas; Hikmet, Feria; Sivertsson, Åsa; Lindskog, Cecilia; Øystese, Kristin A B; Jørgensen, Anders P; Bollerslev, Jens; Casar-Borota, Olivera. TGFBR3L-An Uncharacterised Pituitary Specific Membrane Protein Detected in the Gonadotroph Cells in Non-Neoplastic and Tumour Tissue. Cancers. 2020;13(1) PubMed |
| Hallén, Tobias; Johannsson, Gudmundur; Dahlén, Rahil; Glad, Camilla A M; Örndal, Charlotte; Engvall, Angelica; Carén, Helena; Skoglund, Thomas; Olsson, Daniel S. Genome-wide DNA Methylation Differences in Nonfunctioning Pituitary Adenomas With and Without Postsurgical Progression. The Journal Of Clinical Endocrinology And Metabolism. 2022;107(8):2318-2328. PubMed |